(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE58

ASFUM1_4.PE58        Location/Qualifiers
FT   CDS             190535..191179
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16273700"
FT                   /orf_name="AFUA_4G00690"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84349.1"
FT                   /db_xref="HOGENOM:HBG533752"
FT                   /db_xref="UniParc:UPI00005202D9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W992"
FT                   /transl_table=1
FT                   /translation="MACSSSCLEPNFTTLSGRYCADAPRVTLVVAPAARKEPPFDTRPM
FT                   LQRLKTLHIISNDVRDVYSHWQFPPFFHLPSLRNVNMGTVKEYKGWTRLNHPAVSSTSG
FT                   KSPVASLVLESHCNGRDGVAEFITSCANLKEFRYQHDDDEDWAQTCKNFQPQKIYKALL
FT                   TQKHSLEVLHLSHNVQVSRFPSDDKDENGPVPLDLITGGAQKPTGYSYPHR"
     MACSSSCLEP NFTTLSGRYC ADAPRVTLVV APAARKEPPF DTRPMLQRLK TLHIISNDVR        60
     DVYSHWQFPP FFHLPSLRNV NMGTVKEYKG WTRLNHPAVS STSGKSPVAS LVLESHCNGR       120
     DGVAEFITSC ANLKEFRYQH DDDEDWAQTC KNFQPQKIYK ALLTQKHSLE VLHLSHNVQV       180
     SRFPSDDKDE NGPVPLDLIT GGAQKPTGYS YPHR                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page