(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE6

ASFUM1_4.PE6         Location/Qualifiers
FT   CDS             join(complement(37469..37684),complement(36940..37418),
FT                   complement(36547..36884),complement(35916..36496))
FT                   /codon_start=1
FT                   /gene_family="HOG000159003" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19905461"
FT                   /orf_name="AFUA_4G00150"
FT                   /product="MFS maltose transporter, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL84403.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG054314"
FT                   /db_xref="HOGENOM:HBG328361"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051FE69"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W938"
FT                   /transl_table=1
FT                   /translation="MDNVTEKQTSALELEEQPVSKGGPVYDVNEKVGLDRAGAINAEDV
FT                   EHKMTVVEAVKAYPAASWWAFVMSCTIIMESYCVFLMGQFIATKRFARDYGVWSDVKQD
FT                   FIIEASWQSAFQCSGPVGAFIGVFIAGPITSWIGYRWATIGGLMFLNAFIFIFYFGNSQ
FT                   GMFLASQILEGIPWGIFVANAPAYCSEIVPMRLRAPATQMLQMFWAIGSIIVGGITYHY
FT                   QSRDDPTAYRIPIALQWMFPTPLAILLYLAPESPWWLVRKGRLADAEKAVRRLGRASAN
FT                   DDPADAVAMMRRTIELEKTEKKPSLVELWKGTDLYRTLIVCGVYASQNLTGNLIANQAV
FT                   YFFKQAGMADNTAFALGLITSALQWIMVMLSWILTTYLGRRTIYVYGQLINCVFLVALG
FT                   IAASVGASKAASNAQASLGLIVSVLFCLGPAPASWVIIGETSSVRLRPLTTGIGRGAYY
FT                   VVNIPCIFLASYMLNADKWNLGGKSGYVWAGTAFICTFMSWLWIPEMKDRSFREIDILF
FT                   KRRVPARKWKQTVVDINDDE"
     MDNVTEKQTS ALELEEQPVS KGGPVYDVNE KVGLDRAGAI NAEDVEHKMT VVEAVKAYPA        60
     ASWWAFVMSC TIIMESYCVF LMGQFIATKR FARDYGVWSD VKQDFIIEAS WQSAFQCSGP       120
     VGAFIGVFIA GPITSWIGYR WATIGGLMFL NAFIFIFYFG NSQGMFLASQ ILEGIPWGIF       180
     VANAPAYCSE IVPMRLRAPA TQMLQMFWAI GSIIVGGITY HYQSRDDPTA YRIPIALQWM       240
     FPTPLAILLY LAPESPWWLV RKGRLADAEK AVRRLGRASA NDDPADAVAM MRRTIELEKT       300
     EKKPSLVELW KGTDLYRTLI VCGVYASQNL TGNLIANQAV YFFKQAGMAD NTAFALGLIT       360
     SALQWIMVML SWILTTYLGR RTIYVYGQLI NCVFLVALGI AASVGASKAA SNAQASLGLI       420
     VSVLFCLGPA PASWVIIGET SSVRLRPLTT GIGRGAYYVV NIPCIFLASY MLNADKWNLG       480
     GKSGYVWAGT AFICTFMSWL WIPEMKDRSF REIDILFKRR VPARKWKQTV VDINDDE          537
//

If you have problems or comments...

PBIL Back to PBIL home page