(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE61

ASFUM1_4.PE61        Location/Qualifiers
FT   CDS             join(complement(195837..196070),complement(195620..195722),
FT                   complement(195197..195576))
FT                   /codon_start=1
FT                   /gene_family="HOG000177463" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16273702"
FT                   /orf_name="AFUA_4G00720"
FT                   /product="Protein phosphatase 2C, putative "
FT                   /EC_number="3.1.3.16"
FT                   /function="phosphoprotein phosphatase activity "
FT                   /protein_id="EAL84346.1"
FT                   /db_xref="GO:0004721"
FT                   /db_xref="HOGENOM:HBG055044"
FT                   /db_xref="HOGENOM:HBG331326"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014045"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="UniParc:UPI000051F748"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W995"
FT                   /transl_table=1
FT                   /translation="MRVSGSRKVAQHAKRHISELLFEGDALQAGRFEDAIRQAIQKEEE
FT                   TLLEECQEGEDKFAISGSTVSVVIVNLNNGVMVHRLTQDHKPENPKEKERIEDAGGVVN
FT                   YASETARIGALNMSRALGDLQYKNPLNNDTMGPSTAGQEIAAMTPSIEQGSFVSSEPSI
FT                   IRVDLRQDRRYILALTTDGVTNVLKDSVIINEIKTRHEGGLGVQQVADELVRGVTQGER
FT                   RDNATCIAVFLDGCLS"
     MRVSGSRKVA QHAKRHISEL LFEGDALQAG RFEDAIRQAI QKEEETLLEE CQEGEDKFAI        60
     SGSTVSVVIV NLNNGVMVHR LTQDHKPENP KEKERIEDAG GVVNYASETA RIGALNMSRA       120
     LGDLQYKNPL NNDTMGPSTA GQEIAAMTPS IEQGSFVSSE PSIIRVDLRQ DRRYILALTT       180
     DGVTNVLKDS VIINEIKTRH EGGLGVQQVA DELVRGVTQG ERRDNATCIA VFLDGCLS         238
//

If you have problems or comments...

PBIL Back to PBIL home page