(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE64

ASFUM1_4.PE64        Location/Qualifiers
FT   CDS             join(complement(202401..202864),complement(202083..202303),
FT                   complement(201853..202028))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16273703"
FT                   /orf_name="AFUA_4G00750"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84343.1"
FT                   /db_xref="HOGENOM:HBG055011"
FT                   /db_xref="UniParc:UPI000051F9B6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W998"
FT                   /transl_table=1
FT                   /translation="MRFLNLLLALSPLAQVSSAIPQEWGNSTGPLGGNLITDPARLSEL
FT                   HEVHNEVIRMLNTGETLPVERSRSLTVHGQHDKRVYQAFGLLGVFVASMFGLKTVEKIT
FT                   DQLLELFTSDDTIWTRKENCRAYFSTQGGGNEEFRTYARDHGNPTSEVHKNVGWIDPEH
FT                   TAPPIHFFEGDQGDSAIGVYSVQYTATDRVAWSGIPDTEKCPFEGLCNPQYIFYHNGYQ
FT                   IVLNTWQSQGRISACQYSQGEDCLGLCSSGVKNQFSRGGVRWGGDCAIPCIDDAGDGYD
FT                   VVPNK"
     MRFLNLLLAL SPLAQVSSAI PQEWGNSTGP LGGNLITDPA RLSELHEVHN EVIRMLNTGE        60
     TLPVERSRSL TVHGQHDKRV YQAFGLLGVF VASMFGLKTV EKITDQLLEL FTSDDTIWTR       120
     KENCRAYFST QGGGNEEFRT YARDHGNPTS EVHKNVGWID PEHTAPPIHF FEGDQGDSAI       180
     GVYSVQYTAT DRVAWSGIPD TEKCPFEGLC NPQYIFYHNG YQIVLNTWQS QGRISACQYS       240
     QGEDCLGLCS SGVKNQFSRG GVRWGGDCAI PCIDDAGDGY DVVPNK                      286
//

If you have problems or comments...

PBIL Back to PBIL home page