(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE67

ASFUM1_4.PE67        Location/Qualifiers
FT   CDS             join(complement(213079..213314),complement(212588..212957))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19905473"
FT                   /orf_name="AFUA_4G00790"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84339.1"
FT                   /db_xref="HOGENOM:HBG054967"
FT                   /db_xref="UniParc:UPI000051EFEC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9A2"
FT                   /transl_table=1
FT                   /translation="MASGKNLPEENTSKGDEKTDDNGRPGLSWHALWLLKHEPHGASID
FT                   MRRLKRDIDWRRHNAGIAGETGGAFYVPEQGKTGLIPVILAAGITVGDSWMAIPMPVPI
FT                   QHTRPRSRHESKTKAMEATLLIRTTGEGVSQVDRGRVRRGLCIPMGRGGRPERGKGERG
FT                   PSFGFPQFLRRRAGLTFYAAVCTESDWGRLDCFAEKWP"
     MASGKNLPEE NTSKGDEKTD DNGRPGLSWH ALWLLKHEPH GASIDMRRLK RDIDWRRHNA        60
     GIAGETGGAF YVPEQGKTGL IPVILAAGIT VGDSWMAIPM PVPIQHTRPR SRHESKTKAM       120
     EATLLIRTTG EGVSQVDRGR VRRGLCIPMG RGGRPERGKG ERGPSFGFPQ FLRRRAGLTF       180
     YAAVCTESDW GRLDCFAEKW P                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page