(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE73

ASFUM1_4.PE73        Location/Qualifiers
FT   CDS             join(239341..239470,239528..239623,239672..240186)
FT                   /codon_start=1
FT                   /gene_family="HOG000200190" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20753589"
FT                   /orf_name="AFUA_4G00860"
FT                   /product="Cell surface protein, putative "
FT                   /protein_id="EAL84332.1"
FT                   /db_xref="HOGENOM:HBG054889"
FT                   /db_xref="HOGENOM:HBG324710"
FT                   /db_xref="UniParc:UPI000051EB29"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9A9"
FT                   /transl_table=1
FT                   /translation="MSNMIHKVKEALTGHHGDSHTTSHGHHDSRAADKVDPRVDSDRDN
FT                   RARHEAMGGTAGPHTSDTANKLDPRVDSDRDNRGNTTSGTYGSSNTYESTSNTYGSSNT
FT                   YENRSNTAGPHGSNIANKLDPRVGSDADNRGLGTGTGTTSGTGAFGSGTGTGTGTTGYG
FT                   TTSSNVGPHDSNIGNKLDPRVDSDQDNRARRQAMAGSSYTGAGTGTGTGATAGPHSSNI
FT                   ANKLDPRVDSDLDNSATMGTQRGF"
     MSNMIHKVKE ALTGHHGDSH TTSHGHHDSR AADKVDPRVD SDRDNRARHE AMGGTAGPHT        60
     SDTANKLDPR VDSDRDNRGN TTSGTYGSSN TYESTSNTYG SSNTYENRSN TAGPHGSNIA       120
     NKLDPRVGSD ADNRGLGTGT GTTSGTGAFG SGTGTGTGTT GYGTTSSNVG PHDSNIGNKL       180
     DPRVDSDQDN RARRQAMAGS SYTGAGTGTG TGATAGPHSS NIANKLDPRV DSDLDNSATM       240
     GTQRGF                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page