(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE88

ASFUM1_4.PE88        Location/Qualifiers
FT   CDS             join(272645..273498,273800..274370,274434..274985)
FT                   /codon_start=1
FT                   /gene_family="HOG000216763" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20753593"
FT                   /orf_name="AFUA_4G01010"
FT                   /product="C6 transcription factor, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL84318.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG054735"
FT                   /db_xref="HOGENOM:HBG324602"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000051E42E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9C3"
FT                   /transl_table=1
FT                   /translation="MADTLKTGEPSGWRIPKACQECRKRKIKCNGVNPCKTCRVRNTLC
FT                   VYRDVIRQRKKKRHGPVDEGLASCESTRTELGTQQPSSPPPQPLGRRNKSASYTFHNSV
FT                   SATHMTSPSCKVQLYYGPTSHFTLMHEIYRGLVSNQTTHPEEPQGEVEEAGAGLDMFSV
FT                   RGIFFGTPAETHDPNKGIGTTVAPVMFMPYELARVFLQRFLSTLYHLVPFWSKELYERQ
FT                   LETLYLPSSGTGSDTCTNSILLMALAMGSLGTQRYRWGDILFERVKASCPSWDDVVNLE
FT                   TVQLWICFHLGRPSSLSSRDVGIAPPKDPFILILIHLTNVMARSANEIYGRPHDSLLQM
FT                   WKLARSITEDLRCYDEKMKLALGFGLDKSPQPGDVGVQQAILTTCKPLTCRLMDGRLRK
FT                   IVYYHTILLTFRPFLIFRGRWLRDTKKSPSATGPNTTKRPTEMPAWLNEACDHAVHAAC
FT                   RTVHHLCEAAIVNEFVRELRYHGFFLTSACFALIYDFMYNEKVATTHLPWVHVGLQCLG
FT                   AMRPGDPITSSISAIQTVLKKLCPSYEWVPPGPVQGQTYAPNLTSSASATPYSNGVAPS
FT                   QVNPMRETFPGGTFLGGYLPTMPNIQVNPLQSDIPEASASVVSSEDLPDFNLSDMGWDF
FT                   DFSTMDLEAFFSIQPTMNPSQPL"
     MADTLKTGEP SGWRIPKACQ ECRKRKIKCN GVNPCKTCRV RNTLCVYRDV IRQRKKKRHG        60
     PVDEGLASCE STRTELGTQQ PSSPPPQPLG RRNKSASYTF HNSVSATHMT SPSCKVQLYY       120
     GPTSHFTLMH EIYRGLVSNQ TTHPEEPQGE VEEAGAGLDM FSVRGIFFGT PAETHDPNKG       180
     IGTTVAPVMF MPYELARVFL QRFLSTLYHL VPFWSKELYE RQLETLYLPS SGTGSDTCTN       240
     SILLMALAMG SLGTQRYRWG DILFERVKAS CPSWDDVVNL ETVQLWICFH LGRPSSLSSR       300
     DVGIAPPKDP FILILIHLTN VMARSANEIY GRPHDSLLQM WKLARSITED LRCYDEKMKL       360
     ALGFGLDKSP QPGDVGVQQA ILTTCKPLTC RLMDGRLRKI VYYHTILLTF RPFLIFRGRW       420
     LRDTKKSPSA TGPNTTKRPT EMPAWLNEAC DHAVHAACRT VHHLCEAAIV NEFVRELRYH       480
     GFFLTSACFA LIYDFMYNEK VATTHLPWVH VGLQCLGAMR PGDPITSSIS AIQTVLKKLC       540
     PSYEWVPPGP VQGQTYAPNL TSSASATPYS NGVAPSQVNP MRETFPGGTF LGGYLPTMPN       600
     IQVNPLQSDI PEASASVVSS EDLPDFNLSD MGWDFDFSTM DLEAFFSIQP TMNPSQPL         658
//

If you have problems or comments...

PBIL Back to PBIL home page