(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE89

ASFUM1_4.PE89        Location/Qualifiers
FT   CDS             join(275753..275904,276630..277556,277603..278286,
FT                   278332..279360,279410..280043)
FT                   /codon_start=1
FT                   /gene_family="HOG000178140" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19059005"
FT                   /orf_name="AFUA_4G01020"
FT                   /product="Sensor histidine kinase/response regulator,
FT                   putative"
FT                   /function="ATP binding"
FT                   /function="two-component response regulator activity "
FT                   /function="two-component sensor activity"
FT                   /biological_process="peptidyl-histidine phosphorylation "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL84317.1"
FT                   /db_xref="GO:0000155"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0018106"
FT                   /db_xref="HOGENOM:HBG054724"
FT                   /db_xref="HOGENOM:HBG326511"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniParc:UPI000051E69A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9C4"
FT                   /transl_table=1
FT                   /translation="MPTFSSSPGIPSGCTTFRMRHPLAKKYPRTCPRLMKEENAGTKPD
FT                   TLLLTEFRSSHSQDGVNEPLEAASARGTIRRRDKSNSAASLIAYAQLAAYRLGCSQSFV
FT                   VRFERGQANIIAEASPSLLLEGGGGVGVDEGHRQAKVLSLRLADGRVVNTPNVIADSTR
FT                   CVIRDLTQDNPSDNQEIQFFAAVPIYDVNKDTMGAVCVVDKTPHLGFGDSEVTSMQEIA
FT                   DLVACNIKDKSAEEDHLQAERLIKGLTTFVSCQVVPDLEQGYHFKRRPSYLPGIDDLSL
FT                   SEKCSVGSPQYTHPQTPGTPPNQLFSRIHERRNSVTVIEGSTVSHSMSFLFSRASALLQ
FT                   KCMELDGVLFLDATRSNARSSCSPSMSDLEVLSKDGDSCINSPGLSAGAWRERVCEPLG
FT                   WASSGSANRCTSQYSISEGLLHDLFAAYPKGAIFNASTLVDCTSQRCGHDTDARGLRHH
FT                   TIILRLVQDLPEARSLLFLPMWNWKSSRWLAGALLWTCDIQRSFEQTDLFYVKAYGDAI
FT                   VSEAAQIDWQATEKSKSDLLSSVSHELRSPLHGMLASVELLRTTDLQPAQLDMLTMIET
FT                   CGLTLMDTLNYLLDFTKINNLTSADAKNDTETSLVDLACEFNLDTLVEDVADTLYAGHR
FT                   SPINASQVAGRYLPSGSMGIISAKGTESATESNDLSVIVGVEPGNWKVRSNPGGWRRIV
FT                   MNLLGNSFKFTKSGFIEVTLARKMEGTGGTKRVYAHLTITDTGCGIAPEYLEHKLFQPF
FT                   TQEDILTEGVGLGLSIVDRLVTNAGGQIDVKSTVGIGTQFEVYIPVEFVDTLDEGAPEQ
FT                   QQPQSVSVSRVCLVGLNVFSSMKTSSQRLSVNTKRRLSVRSALSNAILSQPGWTVSFAD
FT                   TLSQAKGDIGIIEESSLAEKADLEQITTDLTRLIILGQYGSGPSVDPATKKLDVVYVPQ
FT                   PLTPRKLIGALHTLSNLPEAREQIGSSDSMPHRQRSLSEAFVLAKQTESPPVVEGLELG
FT                   EFRGSTPKASTTTDRHVLIVDDNDINLKILATFMRRIGCSYETATNGLVALEKYQQAQR
FT                   QFNYVLMGRLPLLGVMVQLTAIDLSMPVMDGIISTSKIREYEEENSLPRAAIMAVTGVA
FT                   SATMQQQAFAAGIDDFLVKPLSLRDLKRVMMNIA"
     MPTFSSSPGI PSGCTTFRMR HPLAKKYPRT CPRLMKEENA GTKPDTLLLT EFRSSHSQDG        60
     VNEPLEAASA RGTIRRRDKS NSAASLIAYA QLAAYRLGCS QSFVVRFERG QANIIAEASP       120
     SLLLEGGGGV GVDEGHRQAK VLSLRLADGR VVNTPNVIAD STRCVIRDLT QDNPSDNQEI       180
     QFFAAVPIYD VNKDTMGAVC VVDKTPHLGF GDSEVTSMQE IADLVACNIK DKSAEEDHLQ       240
     AERLIKGLTT FVSCQVVPDL EQGYHFKRRP SYLPGIDDLS LSEKCSVGSP QYTHPQTPGT       300
     PPNQLFSRIH ERRNSVTVIE GSTVSHSMSF LFSRASALLQ KCMELDGVLF LDATRSNARS       360
     SCSPSMSDLE VLSKDGDSCI NSPGLSAGAW RERVCEPLGW ASSGSANRCT SQYSISEGLL       420
     HDLFAAYPKG AIFNASTLVD CTSQRCGHDT DARGLRHHTI ILRLVQDLPE ARSLLFLPMW       480
     NWKSSRWLAG ALLWTCDIQR SFEQTDLFYV KAYGDAIVSE AAQIDWQATE KSKSDLLSSV       540
     SHELRSPLHG MLASVELLRT TDLQPAQLDM LTMIETCGLT LMDTLNYLLD FTKINNLTSA       600
     DAKNDTETSL VDLACEFNLD TLVEDVADTL YAGHRSPINA SQVAGRYLPS GSMGIISAKG       660
     TESATESNDL SVIVGVEPGN WKVRSNPGGW RRIVMNLLGN SFKFTKSGFI EVTLARKMEG       720
     TGGTKRVYAH LTITDTGCGI APEYLEHKLF QPFTQEDILT EGVGLGLSIV DRLVTNAGGQ       780
     IDVKSTVGIG TQFEVYIPVE FVDTLDEGAP EQQQPQSVSV SRVCLVGLNV FSSMKTSSQR       840
     LSVNTKRRLS VRSALSNAIL SQPGWTVSFA DTLSQAKGDI GIIEESSLAE KADLEQITTD       900
     LTRLIILGQY GSGPSVDPAT KKLDVVYVPQ PLTPRKLIGA LHTLSNLPEA REQIGSSDSM       960
     PHRQRSLSEA FVLAKQTESP PVVEGLELGE FRGSTPKAST TTDRHVLIVD DNDINLKILA      1020
     TFMRRIGCSY ETATNGLVAL EKYQQAQRQF NYVLMGRLPL LGVMVQLTAI DLSMPVMDGI      1080
     ISTSKIREYE EENSLPRAAI MAVTGVASAT MQQQAFAAGI DDFLVKPLSL RDLKRVMMNI      1140
     A                                                                      1141
//

If you have problems or comments...

PBIL Back to PBIL home page