(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE9

ASFUM1_4.PE9         Location/Qualifiers
FT   CDS             52605..53111
FT                   /codon_start=1
FT                   /gene_family="HOG000253046" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19058736"
FT                   /orf_name="AFUA_4G00195"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27177.1"
FT                   /db_xref="UniParc:UPI0000F51BAF"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA86"
FT                   /transl_table=1
FT                   /translation="MGNVNSITQCFPLQRTYTQTSPSRETREVASNVVTIILTSDTPYA
FT                   IKKRLDESIRTAGWTESLALAILRGLENAIETGAQVAEAASKALARATSEAFEFSREHP
FT                   IFVTILALGVLAILTPWVIEVLGFGELGPIEGSFAASWQRTYAGYVPKRSLFSFFQRVG
FT                   MVWKH"
     MGNVNSITQC FPLQRTYTQT SPSRETREVA SNVVTIILTS DTPYAIKKRL DESIRTAGWT        60
     ESLALAILRG LENAIETGAQ VAEAASKALA RATSEAFEFS REHPIFVTIL ALGVLAILTP       120
     WVIEVLGFGE LGPIEGSFAA SWQRTYAGYV PKRSLFSFFQ RVGMVWKH                    168
//

If you have problems or comments...

PBIL Back to PBIL home page