(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE90

ASFUM1_4.PE90        Location/Qualifiers
FT   CDS             join(complement(280397..280502),complement(280173..280339))
FT                   /codon_start=1
FT                   /gene_family="HOG000200111" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274671"
FT                   /orf_name="AFUA_4G01030"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84316.1"
FT                   /db_xref="HOGENOM:HBG054712"
FT                   /db_xref="UniParc:UPI00005202E2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9C5"
FT                   /transl_table=1
FT                   /translation="MKPTLFVLALAGVALGAKTCTPSFDYCAKKLIADKGFTEADLEVV
FT                   LKAEDLETTDLKNVLFHCKNPGDVGHAKVCPNGCTDPATEGSHGC"
     MKPTLFVLAL AGVALGAKTC TPSFDYCAKK LIADKGFTEA DLEVVLKAED LETTDLKNVL        60
     FHCKNPGDVG HAKVCPNGCT DPATEGSHGC                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page