(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE93

ASFUM1_4.PE93        Location/Qualifiers
FT   CDS             complement(287471..288277)
FT                   /codon_start=1
FT                   /gene_family="HOG000171725" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274672"
FT                   /orf_name="AFUA_4G01060"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84313.2"
FT                   /db_xref="HOGENOM:HBG054679"
FT                   /db_xref="HOGENOM:HBG329730"
FT                   /db_xref="UniParc:UPI0000F51C0B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9C8"
FT                   /transl_table=1
FT                   /translation="MPTFTTTSSNPGLDHRLSSPILEHYVYPTFIAVAWCNAIDLIVLC
FT                   FNTFKRYSGPYFWSLLVSSFCIIPFGLGYVLKIYSITFTNYFLEIAILDAGWSGMVTGQ
FT                   SLVLWSRLNLVLDNRRVLKALLYLIIVDGAVLHTACTALEFATNALPSNGVAIAFDVME
FT                   RVQLVGFCLQELLLSGLYIYKAVPLLKMDADRRSRGVLVQLIVINAVIMALDVSVVIVQ
FT                   YLGLFTLQVTSKALVYSIKLKLEYVILGRLVDVSRVRSPAAARMRL"
     MPTFTTTSSN PGLDHRLSSP ILEHYVYPTF IAVAWCNAID LIVLCFNTFK RYSGPYFWSL        60
     LVSSFCIIPF GLGYVLKIYS ITFTNYFLEI AILDAGWSGM VTGQSLVLWS RLNLVLDNRR       120
     VLKALLYLII VDGAVLHTAC TALEFATNAL PSNGVAIAFD VMERVQLVGF CLQELLLSGL       180
     YIYKAVPLLK MDADRRSRGV LVQLIVINAV IMALDVSVVI VQYLGLFTLQ VTSKALVYSI       240
     KLKLEYVILG RLVDVSRVRS PAAARMRL                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page