(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE99

ASFUM1_4.PE99        Location/Qualifiers
FT   CDS             join(complement(301213..301331),complement(300996..301129),
FT                   complement(300596..300972))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19059007"
FT                   /orf_name="AFUA_4G01115"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27173.1"
FT                   /db_xref="UniParc:UPI0000F51C08"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA90"
FT                   /transl_table=1
FT                   /translation="MTIIKHRHDLDIEAVRKEFPGRGKRVQPPEQWLRCSGVQGIVHTM
FT                   LAPHIDQRSLDSKTMVAVKKRTAQHAKLAAFMNAGPDEIDQILNFPSDPCPAGLWPLHN
FT                   GSFAESGRPLRPSLNADSEIVVSGLCHEADVAAFAALAKTLGISIRWWAQPGEWETTGI
FT                   LSLASAPSDLPCSRKRVLYAAGASSTSPDLLNGVSPTGLSDANTNG"
     MTIIKHRHDL DIEAVRKEFP GRGKRVQPPE QWLRCSGVQG IVHTMLAPHI DQRSLDSKTM        60
     VAVKKRTAQH AKLAAFMNAG PDEIDQILNF PSDPCPAGLW PLHNGSFAES GRPLRPSLNA       120
     DSEIVVSGLC HEADVAAFAA LAKTLGISIR WWAQPGEWET TGILSLASAP SDLPCSRKRV       180
     LYAAGASSTS PDLLNGVSPT GLSDANTNG                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page