(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE10

ASFUM1_6.PE10        Location/Qualifiers
FT   CDS             join(complement(66332..66958),complement(64585..66261),
FT                   complement(64415..64510))
FT                   /codon_start=1
FT                   /gene_family="HOG000217679" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262207"
FT                   /orf_name="AFUA_6G00200"
FT                   /product="C6 transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL84245.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG056496"
FT                   /db_xref="HOGENOM:HBG327554"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000051E68F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8X4"
FT                   /transl_table=1
FT                   /translation="MAQDQDNFPRTTSPPRKRRRPPKSCDPCRRRKVRCDREVPCGPCQ
FT                   RARTSLHCFYRPAVTARSPSTDEDCRLTASCGPEGHTPPPQAVDLQTKIRPAAPTAQSQ
FT                   PQGPNYDQTKIIQDLQNRVRRLEEQLCDLPLSKGAIGPNPSVSPSQALRHLHDRVRGAE
FT                   QQLSDASRPSPSVNGWTIPTTLPRLRIAPNKTKLFGPSHWLHTAEKFQVIGKFDAKEVE
FT                   PSLQDVDTRSEFASIFKDCRQLRQAIKDQESVRLNHPVPDLLGTLPTQAVCDVLVNAYL
FT                   RTFELIYRVIHIPSFWKEYRQLWTQPQSTATSFLMKLVLILALGTTFHPDRNNRVHLRR
FT                   LAHTWIYAAQWWLVGPSEKSTVNLDGLQVGCLLLLARQTNSLPATSWLSAGSVLRMAMA
FT                   MGLHRSPDHFPALSGYQSEMRARLWATVLELTLLSSLDASMPLPFSLEDFDCTAPSNAN
FT                   DEQFDPEAETLPTPQSNEHFTDSSIQILLLKCLQSRVEAVQLLNNQHGRELSYETALRL
FT                   GNELRSACRDIAALFHTSQNQPKQGGRTPGMTDFHLRFLDMYLRRYILFLHRPFMMKAR
FT                   TDPRFYLSRKVCLESCIVIASYAEHLNLPSDTLDDISHLTIVGRGSFKGALSFDVITSL
FT                   GLEIITQLEEEASTRSVGTPAPIIADPLDKMAKAHREPLIRSLEHIQKQLLQIIALGQP
FT                   SLKRYNFLSAILSQIRAMESGQPIQPAIYETVKESLRKSYSLLQASHAARRAQDSVESL
FT                   NMGTDSPLGFDLDALDPALGLEIPSLLFFPGIMNTLSTDVSNQCYN"
     MAQDQDNFPR TTSPPRKRRR PPKSCDPCRR RKVRCDREVP CGPCQRARTS LHCFYRPAVT        60
     ARSPSTDEDC RLTASCGPEG HTPPPQAVDL QTKIRPAAPT AQSQPQGPNY DQTKIIQDLQ       120
     NRVRRLEEQL CDLPLSKGAI GPNPSVSPSQ ALRHLHDRVR GAEQQLSDAS RPSPSVNGWT       180
     IPTTLPRLRI APNKTKLFGP SHWLHTAEKF QVIGKFDAKE VEPSLQDVDT RSEFASIFKD       240
     CRQLRQAIKD QESVRLNHPV PDLLGTLPTQ AVCDVLVNAY LRTFELIYRV IHIPSFWKEY       300
     RQLWTQPQST ATSFLMKLVL ILALGTTFHP DRNNRVHLRR LAHTWIYAAQ WWLVGPSEKS       360
     TVNLDGLQVG CLLLLARQTN SLPATSWLSA GSVLRMAMAM GLHRSPDHFP ALSGYQSEMR       420
     ARLWATVLEL TLLSSLDASM PLPFSLEDFD CTAPSNANDE QFDPEAETLP TPQSNEHFTD       480
     SSIQILLLKC LQSRVEAVQL LNNQHGRELS YETALRLGNE LRSACRDIAA LFHTSQNQPK       540
     QGGRTPGMTD FHLRFLDMYL RRYILFLHRP FMMKARTDPR FYLSRKVCLE SCIVIASYAE       600
     HLNLPSDTLD DISHLTIVGR GSFKGALSFD VITSLGLEII TQLEEEASTR SVGTPAPIIA       660
     DPLDKMAKAH REPLIRSLEH IQKQLLQIIA LGQPSLKRYN FLSAILSQIR AMESGQPIQP       720
     AIYETVKESL RKSYSLLQAS HAARRAQDSV ESLNMGTDSP LGFDLDALDP ALGLEIPSLL       780
     FFPGIMNTLS TDVSNQCYN                                                    799
//

If you have problems or comments...

PBIL Back to PBIL home page