(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE103

ASFUM1_6.PE103       Location/Qualifiers
FT   CDS             complement(372617..373852)
FT                   /codon_start=1
FT                   /gene_family="HOG000229504" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750824"
FT                   /orf_name="AFUA_6G02160"
FT                   /product="3' exoribonuclease family protein "
FT                   /EC_number="3.1.-.-"
FT                   /function="3'-5'-exoribonuclease activity"
FT                   /function="RNA binding"
FT                   /biological_process="RNA processing"
FT                   /protein_id="EAL85823.1"
FT                   /db_xref="GO:0000175"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG056355"
FT                   /db_xref="HOGENOM:HBG737187"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI000051E5BA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCR5"
FT                   /transl_table=1
FT                   /translation="MAPAAASTAAPSAPPSLSLPPSQFARLQPHAYLLAHLSPPPSSNQ
FT                   PSIRANGRATSQFRVTSANTGSLTHTNGSAVVRIGDTAAVCGVRAEILHTDDIASWSVS
FT                   RASAPASINKRRKLIDTTEKPTVTANDDNDDEDDESHIQDLNLLVPNLSLSTGCAPGFI
FT                   PGAPPSALAQSLSHQILSLLHSTRLVRAEDLRIWYQPPNWGAEELERHNEDEQMDVDAQ
FT                   EGDTSAKSREIKAFWVLYIDVMIISLAGNPFDAAWAAVLAALRDTKLPKAWWDVDNEMV
FT                   VCSEAVSEAHKLSLRGMPVASSFCVFEADAASGWRKVIIPDAEEERKIEESDRKGIQRR
FT                   WILADPDGYEESLSQERICIVVDKENGEQGKTVIVKMEKNGGWAADTRELKQLVDISAQ
FT                   RWDDMKRILDSC"
     MAPAAASTAA PSAPPSLSLP PSQFARLQPH AYLLAHLSPP PSSNQPSIRA NGRATSQFRV        60
     TSANTGSLTH TNGSAVVRIG DTAAVCGVRA EILHTDDIAS WSVSRASAPA SINKRRKLID       120
     TTEKPTVTAN DDNDDEDDES HIQDLNLLVP NLSLSTGCAP GFIPGAPPSA LAQSLSHQIL       180
     SLLHSTRLVR AEDLRIWYQP PNWGAEELER HNEDEQMDVD AQEGDTSAKS REIKAFWVLY       240
     IDVMIISLAG NPFDAAWAAV LAALRDTKLP KAWWDVDNEM VVCSEAVSEA HKLSLRGMPV       300
     ASSFCVFEAD AASGWRKVII PDAEEERKIE ESDRKGIQRR WILADPDGYE ESLSQERICI       360
     VVDKENGEQG KTVIVKMEKN GGWAADTREL KQLVDISAQR WDDMKRILDS C                411
//

If you have problems or comments...

PBIL Back to PBIL home page