(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE107

ASFUM1_6.PE107       Location/Qualifiers
FT   CDS             384019..385632
FT                   /codon_start=1
FT                   /gene_family="HOG000202382" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263241"
FT                   /orf_name="AFUA_6G02200"
FT                   /product="C2HC5 finger protein"
FT                   /function="transcription regulator activity"
FT                   /function="zinc ion binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85819.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG056350"
FT                   /db_xref="HOGENOM:HBG327026"
FT                   /db_xref="InterPro:IPR009349"
FT                   /db_xref="UniParc:UPI000051EA71"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCR9"
FT                   /transl_table=1
FT                   /translation="MSNSNLVAWAVPRLAQLLPLDEESLTQIITYSAGLPKEEGAEHLK
FT                   NLLGDSPAAFEFIASFSARRDQTQAQTRSTVPSPVRGGEEQSAATDAYTTDNVNSGTKA
FT                   GAKRGKKAKAPLHSAGPVRRPENFGNVAGGYRKEDQDEEYMSAGTARQVRQDTAALRSK
FT                   GSASSLQVPQRQSALSSLESSAASSRTQSPAPRSSGTPKNPPSASGPVLSDLLPNVKSK
FT                   AAKPSTRQQGGGSSSKGALTTNNISDLTAAIAALEVSTNPTLGNGRQKCNCYATIHPLF
FT                   EPAPNCLNCGKIICSLEGLQPCSFCGTPLLSNEEVQSMIRELRAERGQERMRAHNESVH
FT                   REGGPGPTPVGNSKLDAAKAHRDKLLQFQAQNAKRTRVVDEAADFETPNVASTLWMSPA
FT                   QRALALKKQQRILREMEEQARPEWEKKKTVMSLDIKGGRVTRVYQSAAPAQSSSAAEEK
FT                   EEDVEDVSYEKSKPTGGEAFSRNPLLAAGGLLRPVWKAADDKQERTATKERKQTWRRVQ
FT                   DDNDDNEQWILDGGLHGYTT"
     MSNSNLVAWA VPRLAQLLPL DEESLTQIIT YSAGLPKEEG AEHLKNLLGD SPAAFEFIAS        60
     FSARRDQTQA QTRSTVPSPV RGGEEQSAAT DAYTTDNVNS GTKAGAKRGK KAKAPLHSAG       120
     PVRRPENFGN VAGGYRKEDQ DEEYMSAGTA RQVRQDTAAL RSKGSASSLQ VPQRQSALSS       180
     LESSAASSRT QSPAPRSSGT PKNPPSASGP VLSDLLPNVK SKAAKPSTRQ QGGGSSSKGA       240
     LTTNNISDLT AAIAALEVST NPTLGNGRQK CNCYATIHPL FEPAPNCLNC GKIICSLEGL       300
     QPCSFCGTPL LSNEEVQSMI RELRAERGQE RMRAHNESVH REGGPGPTPV GNSKLDAAKA       360
     HRDKLLQFQA QNAKRTRVVD EAADFETPNV ASTLWMSPAQ RALALKKQQR ILREMEEQAR       420
     PEWEKKKTVM SLDIKGGRVT RVYQSAAPAQ SSSAAEEKEE DVEDVSYEKS KPTGGEAFSR       480
     NPLLAAGGLL RPVWKAADDK QERTATKERK QTWRRVQDDN DDNEQWILDG GLHGYTT          537
//

If you have problems or comments...

PBIL Back to PBIL home page