(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE112

ASFUM1_6.PE112       Location/Qualifiers
FT   CDS             join(complement(401642..401867),complement(401360..401540),
FT                   complement(401226..401332),complement(400818..401167),
FT                   complement(400491..400782),complement(400256..400437))
FT                   /codon_start=1
FT                   /gene_family="HOG000158981" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750825"
FT                   /orf_name="AFUA_6G02242"
FT                   /product="Serine/threonine-protein kinase, putative "
FT                   /EC_number="2.7.1.-"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="EBA27245.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0000F51CED"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA27"
FT                   /transl_table=1
FT                   /translation="MLPLRWLTSASRRTMFTFAKKSLWQVPPTVEPPIPQQEPVDEERC
FT                   PGYNSASFYPANPGEVLNHNLLYGLPETFQVALKIINSNSADDAQHEKEIESHIAHRNP
FT                   GHRGRVVLRTCLDDVEVTGPEGRHICLVYEPMRFVDRRIPLPIATAYIYFLLAGLDYLH
FT                   SECQVVHSDLKLSNILISFENERILTNFIKQQQKMQYKIDGKGGRIIYRCHNDFGALDG
FT                   RDIKNLIPKIADFGLATRLDKLDSQDGVVGKQLGIYPIQPDFYRAPEVILGCGWDFKAD
FT                   IWNFGVLVNRSFGLALMLTILFGKLWNILGSQELFKQVYDADGKYEARSHLAEMIALLG
FT                   PPPKELLARSKTMSDQNWPQPVLNDSGKLCNNAQEFFGGPFFDAEGEFRHNELIPSRSL
FT                   ENTTPLLEQEEQEAFLSFVRQMLTWLPEERKTARELMDHQFLKLGG"
     MLPLRWLTSA SRRTMFTFAK KSLWQVPPTV EPPIPQQEPV DEERCPGYNS ASFYPANPGE        60
     VLNHNLLYGL PETFQVALKI INSNSADDAQ HEKEIESHIA HRNPGHRGRV VLRTCLDDVE       120
     VTGPEGRHIC LVYEPMRFVD RRIPLPIATA YIYFLLAGLD YLHSECQVVH SDLKLSNILI       180
     SFENERILTN FIKQQQKMQY KIDGKGGRII YRCHNDFGAL DGRDIKNLIP KIADFGLATR       240
     LDKLDSQDGV VGKQLGIYPI QPDFYRAPEV ILGCGWDFKA DIWNFGVLVN RSFGLALMLT       300
     ILFGKLWNIL GSQELFKQVY DADGKYEARS HLAEMIALLG PPPKELLARS KTMSDQNWPQ       360
     PVLNDSGKLC NNAQEFFGGP FFDAEGEFRH NELIPSRSLE NTTPLLEQEE QEAFLSFVRQ       420
     MLTWLPEERK TARELMDHQF LKLGG                                             445
//

If you have problems or comments...

PBIL Back to PBIL home page