(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE114

ASFUM1_6.PE114       Location/Qualifiers
FT   CDS             join(complement(406871..407206),complement(404464..406777),
FT                   complement(404264..404355))
FT                   /codon_start=1
FT                   /gene_family="HOG000202360" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263244"
FT                   /orf_name="AFUA_6G02270"
FT                   /product="Ribonuclease P complex subunit Pop1, putative "
FT                   /EC_number="3.1.26.5"
FT                   /function="ribonuclease P activity"
FT                   /biological_process="tRNA 5'-leader removal"
FT                   /protein_id="EAL85812.1"
FT                   /db_xref="GO:0001682"
FT                   /db_xref="GO:0004526"
FT                   /db_xref="HOGENOM:HBG056345"
FT                   /db_xref="HOGENOM:HBG327024"
FT                   /db_xref="InterPro:IPR009723"
FT                   /db_xref="InterPro:IPR012590"
FT                   /db_xref="UniParc:UPI000051F19C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCS6"
FT                   /transl_table=1
FT                   /translation="MASNQPSKRKSAFPGPQPGAAASRKRAKTFDARSLAVQSADAALS
FT                   ASGELNVAAYVEAREFEIRALESGMQRSKSALTSRAFQKVPRALRRRTASHNVKRVPRR
FT                   LRARAKREMIEDNTPTVTARRRRPTEILRLRLETARRLQNLNSKTKAKRAAAKAKRDKE
FT                   TQKALEEAGSHAYNIAPRVPKIKKNKLSRPPPPESKYKKRQRCKTWLPTHMFHAKRAHM
FT                   ATSKDPLWRFAVPLSPTEKSYRPSHRAKGARGAVAWDMSYMSTIQLEGTEEAMEAVLRG
FT                   IGINGQDAWGPKGRKWRAGTRSLHAWAFERDGTQRPIAPITLIRCADGKAEDVEMVDAD
FT                   GPKKKSQKDRKKLFIRVHPSAFLQLWNELLGISKRQNPPVMVEDLRFEIGSIEITGPGS
FT                   TEALLSALKPLVPDGAEPPAGSPEATWTSLLGVSNPSSLPQNAFLGFSVSDPRLHFPPR
FT                   TLKPPASDQEMQNLAILLSTWSPDTTQTSPALFDRRARLTATRQLPRQKAINRRRTLAG
FT                   PGVYPPAEASDPKIPVMILASRSTSQSKNTNAPGTWTVLLPWKCVLPLWYSLMYYPLSS
FT                   GGTVRFGGLKEQRQLAFEAGEPWFPGDFPGTRAGWEWNIREREKAKQEWERRPKGRRTE
FT                   FDSLDLGNGQKGEIGHGWACDWERLVQGPPKISTPEPNEAKEIEQSQDAEQQDTQMSDA
FT                   EQQAVGGHAPPFDIHHLPIAKAEAAINNRSEPTEQAAIATVKISLLHRGSPNPAARIYR
FT                   LPTTNPDLRQEWLRLASDERKSKSRKAPHPQGHLQQSAQPSAAQGDARQKLAASLITPA
FT                   ADTESRKEHLPIPTEEDLIGFVTTGNYNLSEGKGTGIGSILVSKVAASGKGQARERRMC
FT                   IVRNAGERVGRLAFQSEALVFFAYHVQPTFVKTRTYENLEQS"
     MASNQPSKRK SAFPGPQPGA AASRKRAKTF DARSLAVQSA DAALSASGEL NVAAYVEARE        60
     FEIRALESGM QRSKSALTSR AFQKVPRALR RRTASHNVKR VPRRLRARAK REMIEDNTPT       120
     VTARRRRPTE ILRLRLETAR RLQNLNSKTK AKRAAAKAKR DKETQKALEE AGSHAYNIAP       180
     RVPKIKKNKL SRPPPPESKY KKRQRCKTWL PTHMFHAKRA HMATSKDPLW RFAVPLSPTE       240
     KSYRPSHRAK GARGAVAWDM SYMSTIQLEG TEEAMEAVLR GIGINGQDAW GPKGRKWRAG       300
     TRSLHAWAFE RDGTQRPIAP ITLIRCADGK AEDVEMVDAD GPKKKSQKDR KKLFIRVHPS       360
     AFLQLWNELL GISKRQNPPV MVEDLRFEIG SIEITGPGST EALLSALKPL VPDGAEPPAG       420
     SPEATWTSLL GVSNPSSLPQ NAFLGFSVSD PRLHFPPRTL KPPASDQEMQ NLAILLSTWS       480
     PDTTQTSPAL FDRRARLTAT RQLPRQKAIN RRRTLAGPGV YPPAEASDPK IPVMILASRS       540
     TSQSKNTNAP GTWTVLLPWK CVLPLWYSLM YYPLSSGGTV RFGGLKEQRQ LAFEAGEPWF       600
     PGDFPGTRAG WEWNIREREK AKQEWERRPK GRRTEFDSLD LGNGQKGEIG HGWACDWERL       660
     VQGPPKISTP EPNEAKEIEQ SQDAEQQDTQ MSDAEQQAVG GHAPPFDIHH LPIAKAEAAI       720
     NNRSEPTEQA AIATVKISLL HRGSPNPAAR IYRLPTTNPD LRQEWLRLAS DERKSKSRKA       780
     PHPQGHLQQS AQPSAAQGDA RQKLAASLIT PAADTESRKE HLPIPTEEDL IGFVTTGNYN       840
     LSEGKGTGIG SILVSKVAAS GKGQARERRM CIVRNAGERV GRLAFQSEAL VFFAYHVQPT       900
     FVKTRTYENL EQS                                                          913
//

If you have problems or comments...

PBIL Back to PBIL home page