(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE115

ASFUM1_6.PE115       Location/Qualifiers
FT   CDS             join(complement(408429..408478),complement(408055..408331),
FT                   complement(407836..407979),complement(407732..407767))
FT                   /codon_start=1
FT                   /gene_family="HOG000255884" [ FAMILY / ALN / TREE ]
FT                   /evidence="1: Evidence at protein level "
FT                   /gene_id="IGI16263245"
FT                   /gene_name="pmp20"
FT                   /orf_name="AFUA_6G02280"
FT                   /product="Putative peroxiredoxin pmp20 "
FT                   /EC_number="1.11.1.15"
FT                   /function="peroxidase activity"
FT                   /function="peroxiredoxin activity"
FT                   /biological_process="cell redox homeostasis"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="peroxisome"
FT                   /protein_id="EAL85811.1"
FT                   /db_xref="EMBL:AAB95638.1"
FT                   /db_xref="GO:0004601"
FT                   /db_xref="GO:0005777"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="GO:0051920"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG491141"
FT                   /db_xref="HOGENOM:HBG493509"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="UniParc:UPI0000131C89"
FT                   /db_xref="UniProtKB/Swiss-Prot:O43099"
FT                   /transl_table=1
FT                   /translation="MSGLKAGDSFPSDVVFSYIPWSEDKGEITACGIPINYNASKEWAD
FT                   KKVILFALPGAFTPVCSARHVPEYIEKLPEIRAKGVDVVAVLAYNDAYVMSAWGKANQV
FT                   TGDDILFLSDPDARFSKSIGWADEEGRTKRYALVIDHGKITYAALEPAKNHLEFSSAET
FT                   VLKHL"
     MSGLKAGDSF PSDVVFSYIP WSEDKGEITA CGIPINYNAS KEWADKKVIL FALPGAFTPV        60
     CSARHVPEYI EKLPEIRAKG VDVVAVLAYN DAYVMSAWGK ANQVTGDDIL FLSDPDARFS       120
     KSIGWADEEG RTKRYALVID HGKITYAALE PAKNHLEFSS AETVLKHL                    168
//

If you have problems or comments...

PBIL Back to PBIL home page