(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE116

ASFUM1_6.PE116       Location/Qualifiers
FT   CDS             complement(410772..411101)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263246"
FT                   /orf_name="AFUA_6G02290"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85810.1"
FT                   /db_xref="HOGENOM:HBG056343"
FT                   /db_xref="UniParc:UPI000051F412"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCS8"
FT                   /transl_table=1
FT                   /translation="MLFADVYSINVNPINKPAAVTVPVRSKYHVIPAHHSLAHLASFPF
FT                   KRPILEAVAALPAHPIFCVLILVPELHGNTVICESKKLLAESVIMFTLPFAGQERDNRF
FT                   CAREE"
     MLFADVYSIN VNPINKPAAV TVPVRSKYHV IPAHHSLAHL ASFPFKRPIL EAVAALPAHP        60
     IFCVLILVPE LHGNTVICES KKLLAESVIM FTLPFAGQER DNRFCAREE                   109
//

If you have problems or comments...

PBIL Back to PBIL home page