(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE120

ASFUM1_6.PE120       Location/Qualifiers
FT   CDS             join(437032..437356,437405..437517,437701..437868,
FT                   437920..438246)
FT                   /codon_start=1
FT                   /gene_family="HOG000202316" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056121"
FT                   /orf_name="AFUA_6G02350"
FT                   /product="DUF207 domain protein"
FT                   /protein_id="EAL85804.1"
FT                   /db_xref="HOGENOM:HBG247204"
FT                   /db_xref="HOGENOM:HBG327010"
FT                   /db_xref="InterPro:IPR003827"
FT                   /db_xref="UniParc:UPI000051F417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCT4"
FT                   /transl_table=1
FT                   /translation="MSNPEVCTIPEVFESRKRKILADLSVPDTEYTDLSPKGSVDEGIR
FT                   DLIRDINALPGLVTTSSCSGRISVFLEGRKKQNDHQQDQRQFAPSGGKGAGKWLYVSHD
FT                   PLNGHCPRSLHELFGMVPGNGKPPGLKGGHAPRLVRFHYDPMILHIMAATLHHAHPVLS
FT                   AAATSGFRESGLQSLRCLEGENGPSPIVAVRSAGLSLESEPVIRSLVTEEYLQMLVAIS
FT                   NERFLVNAERKERFRTNLLKLCSTEQLCGPKTRSKAKHEGWEDPAARRERKRTEGLMRK
FT                   KFLETQTKSADHSSTGTYEMGWGSGPMPL"
     MSNPEVCTIP EVFESRKRKI LADLSVPDTE YTDLSPKGSV DEGIRDLIRD INALPGLVTT        60
     SSCSGRISVF LEGRKKQNDH QQDQRQFAPS GGKGAGKWLY VSHDPLNGHC PRSLHELFGM       120
     VPGNGKPPGL KGGHAPRLVR FHYDPMILHI MAATLHHAHP VLSAAATSGF RESGLQSLRC       180
     LEGENGPSPI VAVRSAGLSL ESEPVIRSLV TEEYLQMLVA ISNERFLVNA ERKERFRTNL       240
     LKLCSTEQLC GPKTRSKAKH EGWEDPAARR ERKRTEGLMR KKFLETQTKS ADHSSTGTYE       300
     MGWGSGPMPL                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page