(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE121

ASFUM1_6.PE121       Location/Qualifiers
FT   CDS             join(complement(440400..440939),complement(439897..440313),
FT                   complement(439764..439826),complement(439374..439682),
FT                   complement(438741..439286))
FT                   /codon_start=1
FT                   /gene_family="HOG000202305" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902853"
FT                   /orf_name="AFUA_6G02360"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85803.1"
FT                   /db_xref="HOGENOM:HBG056337"
FT                   /db_xref="HOGENOM:HBG327009"
FT                   /db_xref="UniParc:UPI000051FFDD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCT5"
FT                   /transl_table=1
FT                   /translation="MEGKETNGQASGHESGYAFTSPYPQSYNMLPFGAPGMPGFAPRQG
FT                   QYMMAPGNPNPSQPLQRGGPFMYSPFYGMQSMAHALPGVIGQAHGMHSPMPASNTKLQL
FT                   SVRPKQTGFTPTGSHWAPRSSLHQLLEHDSASRDIATQAVDCEKSFDTVALPAEMPIGS
FT                   QVHNRMPSQWGVVKIANIPYSVTRQEIIQFLGRQARLITPQQGCAIHIIMERSTAKTMD
FT                   CYAEFQSANDAQETATRINRIYETGRAPRLGNRSVDVEFSNQDALLKDLFPRAKCIIWK
FT                   DAMPTAVPNDDPFSTGFSGFFTSEEIVNAIRHAEIPHRSPFCAKCPQRTYESTISTLYK
FT                   FPWYATKLYTVHDRNQLFELVSRHILSLVARVKRSNTVGLDQRLLRELLYAGLNCPAFN
FT                   ERQKYTLCVNSEDTTEILKFPDMGKWFPFDTLVKLPKSEESTLLYYVKLISKGTLHDRT
FT                   DMKLPNNFPLTNIHLESPYGPIWFEWPSNIAKTMTWEDASLHEMSILSHLVLTGWMKND
FT                   QENTKKSGLLPDSTTGSSRESHANTIVSSGSDNSPIDVRTPSRTDNLATPSRRASVQLG
FT                   SRSSFAESSDDSWRRAIYMHSSAGMRGRFPGHRNTQSSPTCLPSAGNP"
     MEGKETNGQA SGHESGYAFT SPYPQSYNML PFGAPGMPGF APRQGQYMMA PGNPNPSQPL        60
     QRGGPFMYSP FYGMQSMAHA LPGVIGQAHG MHSPMPASNT KLQLSVRPKQ TGFTPTGSHW       120
     APRSSLHQLL EHDSASRDIA TQAVDCEKSF DTVALPAEMP IGSQVHNRMP SQWGVVKIAN       180
     IPYSVTRQEI IQFLGRQARL ITPQQGCAIH IIMERSTAKT MDCYAEFQSA NDAQETATRI       240
     NRIYETGRAP RLGNRSVDVE FSNQDALLKD LFPRAKCIIW KDAMPTAVPN DDPFSTGFSG       300
     FFTSEEIVNA IRHAEIPHRS PFCAKCPQRT YESTISTLYK FPWYATKLYT VHDRNQLFEL       360
     VSRHILSLVA RVKRSNTVGL DQRLLRELLY AGLNCPAFNE RQKYTLCVNS EDTTEILKFP       420
     DMGKWFPFDT LVKLPKSEES TLLYYVKLIS KGTLHDRTDM KLPNNFPLTN IHLESPYGPI       480
     WFEWPSNIAK TMTWEDASLH EMSILSHLVL TGWMKNDQEN TKKSGLLPDS TTGSSRESHA       540
     NTIVSSGSDN SPIDVRTPSR TDNLATPSRR ASVQLGSRSS FAESSDDSWR RAIYMHSSAG       600
     MRGRFPGHRN TQSSPTCLPS AGNP                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page