(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE122

ASFUM1_6.PE122       Location/Qualifiers
FT   CDS             join(complement(442663..442665),complement(442284..442610),
FT                   complement(442109..442234),complement(442007..442051),
FT                   complement(441939..441947))
FT                   /codon_start=1
FT                   /gene_family="HOG000202303" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750828"
FT                   /orf_name="AFUA_6G02370"
FT                   /product="ARP2/3 complex 20 kDa subunit (P20-ARC), putative"
FT                   /biological_process="actin filament polymerization "
FT                   /cellular_component="cytoskeleton"
FT                   /protein_id="EAL85802.1"
FT                   /db_xref="GO:0005856"
FT                   /db_xref="GO:0030041"
FT                   /db_xref="HOGENOM:HBG026656"
FT                   /db_xref="HOGENOM:HBG314395"
FT                   /db_xref="InterPro:IPR008384"
FT                   /db_xref="UniParc:UPI000051E834"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCT6"
FT                   /transl_table=1
FT                   /translation="MSQSLRPYLQCVRSSLTAALAISNFASQTSERHNVPEIEAQSSPE
FT                   LLLNPLTISRNENEKVLIEPSVNSVRVSIRIKQADEIEHILVHKFTRFLTQRAESFFIL
FT                   RRKPVKGYDISFLITNFHTEAMLKHKLVDFIIQFMEEVDKEISEMKLFLNARARFVAES
FT                   FLTPFD"
     MSQSLRPYLQ CVRSSLTAAL AISNFASQTS ERHNVPEIEA QSSPELLLNP LTISRNENEK        60
     VLIEPSVNSV RVSIRIKQAD EIEHILVHKF TRFLTQRAES FFILRRKPVK GYDISFLITN       120
     FHTEAMLKHK LVDFIIQFME EVDKEISEMK LFLNARARFV AESFLTPFD                   169
//

If you have problems or comments...

PBIL Back to PBIL home page