(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE123

ASFUM1_6.PE123       Location/Qualifiers
FT   CDS             join(443140..444793,444856..444917)
FT                   /codon_start=1
FT                   /gene_family="HOG000202292" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18207414"
FT                   /orf_name="AFUA_6G02380"
FT                   /product="Ubiquitin C-terminal hydrolase, putative "
FT                   /EC_number="3.1.2.15"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="EAL85801.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="HOGENOM:HBG027359"
FT                   /db_xref="HOGENOM:HBG524155"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="UniParc:UPI000051E826"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCT7"
FT                   /transl_table=1
FT                   /translation="MFSVIVKHQGKRHEVELDPSANGETLKYQMYSLTGVEPERQKILV
FT                   KGGQLKDETPLSALNAKPGQTFMMMGTPSGGQDAVDLGRPKEPVKFLEDMTEAEAARAE
FT                   GAIPAGLQNLGNTCYLNSTLQTLRSVPELQQELLNYKPSAGSSAGSRLSDLSSLGLGGL
FT                   GASMDLVSSLRDLFKQMSETQEGFPPLMFLNALRSVFPQFAQKDRNGHGYAQQDAEEAW
FT                   SQIVTQLRSKLVIKEGEGDSATEVSFVDKFLAGRFESVTECDDPAAKAAGEEATKSSDI
FT                   FFKLDCHIGKETNHLHDGILAGLEEKIEKRSPTLDRDAVYTKRSRIARLPKYLTVHFVR
FT                   FFWKRETQKKAKIMRKVTFPAELDVVEFCTEELKKQLIPIRDKVRDIRKEEVDVERARK
FT                   RQKLAHQREEELKRAAESDAGLEPLQKKKATEGQKEATKSGEQDGDTAMTDVFKSDAEY
FT                   EAEKYASILAAKKELAALIDPKLASDAGTNNSGLYELRAVITHQGASADSGHYTSYVKK
FT                   QPNGKGVEDGKWWWFNDEKVTEVDGEKIETLAGGGESHSALILLYRAVDLPTAE"
     MFSVIVKHQG KRHEVELDPS ANGETLKYQM YSLTGVEPER QKILVKGGQL KDETPLSALN        60
     AKPGQTFMMM GTPSGGQDAV DLGRPKEPVK FLEDMTEAEA ARAEGAIPAG LQNLGNTCYL       120
     NSTLQTLRSV PELQQELLNY KPSAGSSAGS RLSDLSSLGL GGLGASMDLV SSLRDLFKQM       180
     SETQEGFPPL MFLNALRSVF PQFAQKDRNG HGYAQQDAEE AWSQIVTQLR SKLVIKEGEG       240
     DSATEVSFVD KFLAGRFESV TECDDPAAKA AGEEATKSSD IFFKLDCHIG KETNHLHDGI       300
     LAGLEEKIEK RSPTLDRDAV YTKRSRIARL PKYLTVHFVR FFWKRETQKK AKIMRKVTFP       360
     AELDVVEFCT EELKKQLIPI RDKVRDIRKE EVDVERARKR QKLAHQREEE LKRAAESDAG       420
     LEPLQKKKAT EGQKEATKSG EQDGDTAMTD VFKSDAEYEA EKYASILAAK KELAALIDPK       480
     LASDAGTNNS GLYELRAVIT HQGASADSGH YTSYVKKQPN GKGVEDGKWW WFNDEKVTEV       540
     DGEKIETLAG GGESHSALIL LYRAVDLPTA E                                      571
//

If you have problems or comments...

PBIL Back to PBIL home page