(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE124

ASFUM1_6.PE124       Location/Qualifiers
FT   CDS             join(445384..445812,446001..446378)
FT                   /codon_start=1
FT                   /gene_family="HOG000202271" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263249"
FT                   /orf_name="AFUA_6G02390"
FT                   /product="Thioesterase family protein "
FT                   /protein_id="EAL85800.1"
FT                   /db_xref="HOGENOM:HBG056335"
FT                   /db_xref="HOGENOM:HBG327007"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="UniParc:UPI00005206C8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCT8"
FT                   /transl_table=1
FT                   /translation="MLGPRRIFQSRPRCNATQLKSVHLSKPRLSRHTSTIAPAEPPTTK
FT                   SRWPRRLAYAGIFGGLGVAAGKWMDEKVSAPAVPGTVEDAAKLEEINHVFEHGLPIVQE
FT                   LRNNPDYLETNAYEGFSEEDKAHRLTSGPLRGSRGLALQRVFYNDKEKKVICVVYLGSG
FT                   LEGWPTVVHGGVLATVLDENLGRAAIRHFPARTGVTANLEINYRAPVYSGNFYTFHSQV
FT                   DPERSTERKAFVTGEIRDPVGRVCAQASAIFVVPKGFKLRKIGERF"
     MLGPRRIFQS RPRCNATQLK SVHLSKPRLS RHTSTIAPAE PPTTKSRWPR RLAYAGIFGG        60
     LGVAAGKWMD EKVSAPAVPG TVEDAAKLEE INHVFEHGLP IVQELRNNPD YLETNAYEGF       120
     SEEDKAHRLT SGPLRGSRGL ALQRVFYNDK EKKVICVVYL GSGLEGWPTV VHGGVLATVL       180
     DENLGRAAIR HFPARTGVTA NLEINYRAPV YSGNFYTFHS QVDPERSTER KAFVTGEIRD       240
     PVGRVCAQAS AIFVVPKGFK LRKIGERF                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page