(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE128

ASFUM1_6.PE128       Location/Qualifiers
FT   CDS             join(456861..457671,457734..457865,457905..457951,
FT                   458016..458399,458475..458522)
FT                   /codon_start=1
FT                   /gene_family="HOG000217791" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207416"
FT                   /orf_name="AFUA_6G02430"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85796.2"
FT                   /db_xref="HOGENOM:HBG056332"
FT                   /db_xref="UniParc:UPI0000F51CD4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCU2"
FT                   /transl_table=1
FT                   /translation="MSPDPHAADRKAQKQREKKMNAERLKYQKQQSEYFPLTDSFIVPK
FT                   SRVARALDTCVRYLQTTYCVVSFPTHHFVVSGIKNSGKQLKLRSRSFESESRFSSCDVT
FT                   HPASDLPTVPNLKDLPEKVRKRPERSSQVVNKASISLSLLCCPRNCGSVKLTVKQKDPA
FT                   RTSPKESSFTRKFSRTMTGDSVKKVSSMDRKSWQTQSSSAGSGGKTRSIRSASVTATGT
FT                   DLGEGDAATRLEGGLKKLTISEGLKREGKPAAISTAQPKVIKCLRSPGDYVFIDIETPG
FT                   EKSNANSNSSPGISPKAKSAEVGSGEDESGEHEAEAANDQDPRSIVEKRLEVIRHIVKN
FT                   IFQGQSDEDTKTGKALQNAKKWDTKNTKCIKCFGDCPVCSKACCIFDVARRTAAQADST
FT                   PEHAEAANQILKLIQRLGNSVLEATTYSLCTTPGGCGRYVCSDCWGICPVELCHDVQCK
FT                   DCKEDPWAACDWHDY"
     MSPDPHAADR KAQKQREKKM NAERLKYQKQ QSEYFPLTDS FIVPKSRVAR ALDTCVRYLQ        60
     TTYCVVSFPT HHFVVSGIKN SGKQLKLRSR SFESESRFSS CDVTHPASDL PTVPNLKDLP       120
     EKVRKRPERS SQVVNKASIS LSLLCCPRNC GSVKLTVKQK DPARTSPKES SFTRKFSRTM       180
     TGDSVKKVSS MDRKSWQTQS SSAGSGGKTR SIRSASVTAT GTDLGEGDAA TRLEGGLKKL       240
     TISEGLKREG KPAAISTAQP KVIKCLRSPG DYVFIDIETP GEKSNANSNS SPGISPKAKS       300
     AEVGSGEDES GEHEAEAAND QDPRSIVEKR LEVIRHIVKN IFQGQSDEDT KTGKALQNAK       360
     KWDTKNTKCI KCFGDCPVCS KACCIFDVAR RTAAQADSTP EHAEAANQIL KLIQRLGNSV       420
     LEATTYSLCT TPGGCGRYVC SDCWGICPVE LCHDVQCKDC KEDPWAACDW HDY              473
//

If you have problems or comments...

PBIL Back to PBIL home page