(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE13

ASFUM1_6.PE13        Location/Qualifiers
FT   CDS             join(70944..70973,71030..71440,71494..71946)
FT                   /codon_start=1
FT                   /gene_family="HOG000158905" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902573"
FT                   /orf_name="AFUA_6G00230"
FT                   /product="NmrA-like family protein "
FT                   /EC_number="1.3.1.-"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84242.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG050941"
FT                   /db_xref="HOGENOM:HBG329511"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051EB22"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8X7"
FT                   /transl_table=1
FT                   /translation="MAYKNVVLVGAGNIGRIILRGLEDSSQFNITVLSRKESSAVFPDS
FT                   VNVWKTDYSKSDLEAAFTGQDVVISALGALGFTEQRKLVDAAVQSGVKRFLPSEFSCNS
FT                   QNGTVIELLPLFQQKADIIQYLKSKESTGLTWTSLVTSLLFDWGLENGFLGYDISSRTA
FT                   TIWDDGNKKFTLTNEGHLSKAVVSVLQRPNETKNQILYIASVETSQNEILNAFETVTGC
FT                   KWSIIRTTTEEQVTEARMKLSKGDFDGALTLVRATSYSNLPGLKSNYAKGFKVANDILG
FT                   LEWANVEDTVRTVVSK"
     MAYKNVVLVG AGNIGRIILR GLEDSSQFNI TVLSRKESSA VFPDSVNVWK TDYSKSDLEA        60
     AFTGQDVVIS ALGALGFTEQ RKLVDAAVQS GVKRFLPSEF SCNSQNGTVI ELLPLFQQKA       120
     DIIQYLKSKE STGLTWTSLV TSLLFDWGLE NGFLGYDISS RTATIWDDGN KKFTLTNEGH       180
     LSKAVVSVLQ RPNETKNQIL YIASVETSQN EILNAFETVT GCKWSIIRTT TEEQVTEARM       240
     KLSKGDFDGA LTLVRATSYS NLPGLKSNYA KGFKVANDIL GLEWANVEDT VRTVVSK          297
//

If you have problems or comments...

PBIL Back to PBIL home page