(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE131

ASFUM1_6.PE131       Location/Qualifiers
FT   CDS             join(complement(462632..463114),complement(462471..462560))
FT                   /codon_start=1
FT                   /gene_family="HOG000106325" [ FAMILY / ALN / TREE ]
FT                   /evidence="1: Evidence at protein level "
FT                   /gene_id="IGI20750829"
FT                   /orf_name="AFUA_6G02460"
FT                   /product="Glucosamine 6-phosphate acetyltransferase,
FT                   putative"
FT                   /EC_number="2.3.1.4"
FT                   /function="glucosamine 6-phosphate N-acetyltransferase
FT                   activity"
FT                   /protein_id="EAL85793.1"
FT                   /db_xref="GO:0004343"
FT                   /db_xref="HOGENOM:HBG341300"
FT                   /db_xref="HOGENOM:HBG736206"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="PDB:2VEZ"
FT                   /db_xref="PDB:2VXK"
FT                   /db_xref="UniParc:UPI000051FB55"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCU5"
FT                   /transl_table=1
FT                   /translation="MTNATIAPTTTAAPVTKSVDAPTADENTPLFSPSLISPDVLAVLP
FT                   ADYTIRPLCRSDYKRGYLDVLRVLTTVGDINEEQWNSRYEWIRARSDEYYLLVVCDGEG
FT                   RIVGTGSLVVERKFIHSLGMVGHIEDIAVEKGQQGKKLGLRIIQALDYVAEKVGCYKTI
FT                   LDCSEANEGFYIKCGFKRAGLEMAHYY"
     MTNATIAPTT TAAPVTKSVD APTADENTPL FSPSLISPDV LAVLPADYTI RPLCRSDYKR        60
     GYLDVLRVLT TVGDINEEQW NSRYEWIRAR SDEYYLLVVC DGEGRIVGTG SLVVERKFIH       120
     SLGMVGHIED IAVEKGQQGK KLGLRIIQAL DYVAEKVGCY KTILDCSEAN EGFYIKCGFK       180
     RAGLEMAHYY                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page