(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE134

ASFUM1_6.PE134       Location/Qualifiers
FT   CDS             join(469439..470509,470588..470693,470753..470814)
FT                   /codon_start=1
FT                   /gene_family="HOG000185898" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16263253"
FT                   /orf_name="AFUA_6G02490"
FT                   /product="Aspartate transaminase, putative "
FT                   /EC_number="2.6.1.1"
FT                   /function="L-aspartate:2-oxoglutarate aminotransferase
FT                   activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="biosynthetic process"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="EAL85790.1"
FT                   /db_xref="GO:0004069"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG122224"
FT                   /db_xref="HOGENOM:HBG446828"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000051F666"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCU8"
FT                   /transl_table=1
FT                   /translation="MSVLSTLAPVPPDEIFALNRAYATDPFPQKVSLGVGVYRTDDGKP
FT                   WPLPCVREAEKQLLAEDSLTRHEYTAIEGDIPFLELARDIMFGFDGKNAAEKHKSRIGS
FT                   VQTVAGTGANHLGALFLATHMKPGKVWLSNPSWANHMTIWELAGVPRKTYPYYNPTTRS
FT                   FDFDGMMATLEAEAQQGDVILLHACAHNPTGLDPNKEQWKAIADLCERKKIFPFFDSAY
FT                   QGFASGSLEEDAWAVRYFLNEKPGMEMCVAQSFSKNFGLYGQRVGAFHYVLPQGSESLR
FT                   DTVVVNLCHLIRGEYSMGPTAGCNLVKKVLTNEELTAQWHKDLKVMSSRIRSMRKALYD
FT                   ELLRLQTPGSWRHIVEQNGMFSYTGLTPAQVHSLKDKYHIYLLKSGRASISGLSEKNVA
FT                   YVAQAIDDVVRNV"
     MSVLSTLAPV PPDEIFALNR AYATDPFPQK VSLGVGVYRT DDGKPWPLPC VREAEKQLLA        60
     EDSLTRHEYT AIEGDIPFLE LARDIMFGFD GKNAAEKHKS RIGSVQTVAG TGANHLGALF       120
     LATHMKPGKV WLSNPSWANH MTIWELAGVP RKTYPYYNPT TRSFDFDGMM ATLEAEAQQG       180
     DVILLHACAH NPTGLDPNKE QWKAIADLCE RKKIFPFFDS AYQGFASGSL EEDAWAVRYF       240
     LNEKPGMEMC VAQSFSKNFG LYGQRVGAFH YVLPQGSESL RDTVVVNLCH LIRGEYSMGP       300
     TAGCNLVKKV LTNEELTAQW HKDLKVMSSR IRSMRKALYD ELLRLQTPGS WRHIVEQNGM       360
     FSYTGLTPAQ VHSLKDKYHI YLLKSGRASI SGLSEKNVAY VAQAIDDVVR NV               412
//

If you have problems or comments...

PBIL Back to PBIL home page