(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE135

ASFUM1_6.PE135       Location/Qualifiers
FT   CDS             join(complement(472710..472781),complement(471318..472619))
FT                   /codon_start=1
FT                   /gene_family="HOG000202216" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056122"
FT                   /orf_name="AFUA_6G02510"
FT                   /product="Chitin biosynthesis protein (Chs5), putative "
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL85789.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG252834"
FT                   /db_xref="HOGENOM:HBG326972"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR008957"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniParc:UPI000051F8C9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCU9"
FT                   /transl_table=1
FT                   /translation="MLVSLTVGKVDAGVAVLLTQDNRLDSTLLVRTVGRFTAANLGNLQ
FT                   IEFPSVLLPNSITSGSIVDITVSRNHAAEAASTSAFQALQKRILNTYGVKTPAPPVLRL
FT                   RNATQTSLVLEWDPIDLATASLKSLSLYRNGSKAGSIPRPLETRSTKISGLAIDTEYSF
FT                   HLVLRTTAGTYQSEKLTCRTHKMTDLSGITVTPGVLPEQQKEALAAALERIGGKMIDTV
FT                   RIDTTHFVCTEGRGPLWEKAVEMNIPVVVPEWVDACEAEGTIVGVRGYYLNADPKARQL
FT                   GPIHASTHQHTRSSVSMATNAPSQSQSQSQSQPQSQSQSRLSLQPQPTHQRELSVGDPP
FT                   VTPFPGADMSGQPRADEREVSSDEEDLPPPPPPKDDAAGAEPAVNGKPESTSPEGVVSS
FT                   GDKEERSESDEKHDEKDEDETAHEQAEEKQEQEEPTSNDSDAKGKGKEGEGDFSEISL"
     MLVSLTVGKV DAGVAVLLTQ DNRLDSTLLV RTVGRFTAAN LGNLQIEFPS VLLPNSITSG        60
     SIVDITVSRN HAAEAASTSA FQALQKRILN TYGVKTPAPP VLRLRNATQT SLVLEWDPID       120
     LATASLKSLS LYRNGSKAGS IPRPLETRST KISGLAIDTE YSFHLVLRTT AGTYQSEKLT       180
     CRTHKMTDLS GITVTPGVLP EQQKEALAAA LERIGGKMID TVRIDTTHFV CTEGRGPLWE       240
     KAVEMNIPVV VPEWVDACEA EGTIVGVRGY YLNADPKARQ LGPIHASTHQ HTRSSVSMAT       300
     NAPSQSQSQS QSQPQSQSQS RLSLQPQPTH QRELSVGDPP VTPFPGADMS GQPRADEREV       360
     SSDEEDLPPP PPPKDDAAGA EPAVNGKPES TSPEGVVSSG DKEERSESDE KHDEKDEDET       420
     AHEQAEEKQE QEEPTSNDSD AKGKGKEGEG DFSEISL                                457
//

If you have problems or comments...

PBIL Back to PBIL home page