(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE136

ASFUM1_6.PE136       Location/Qualifiers
FT   CDS             complement(473217..473759)
FT                   /codon_start=1
FT                   /gene_family="HOG000202205" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902855"
FT                   /orf_name="AFUA_6G02515"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27243.1"
FT                   /db_xref="HOGENOM:HBG325070"
FT                   /db_xref="UniParc:UPI0000F51CE7"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA25"
FT                   /transl_table=1
FT                   /translation="MMTGQTVQRKLVKSTSQFYMRYNPKAVLPPVASRYILSETHPIRP
FT                   KIQHLYANRDPSTLWWRVNPQPLQSFKRVVRSWATRRARLAFRQALAAQGFDAEGRRLV
FT                   SEASGSMATRSPKEGLQGSLEIAVLPQSVKAGYDTIRKEMDYLLRTLLRHLRDGKKQTN
FT                   TFRKQGEDHKRIPTNTS"
     MMTGQTVQRK LVKSTSQFYM RYNPKAVLPP VASRYILSET HPIRPKIQHL YANRDPSTLW        60
     WRVNPQPLQS FKRVVRSWAT RRARLAFRQA LAAQGFDAEG RRLVSEASGS MATRSPKEGL       120
     QGSLEIAVLP QSVKAGYDTI RKEMDYLLRT LLRHLRDGKK QTNTFRKQGE DHKRIPTNTS       180
//

If you have problems or comments...

PBIL Back to PBIL home page