(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE137

ASFUM1_6.PE137       Location/Qualifiers
FT   CDS             join(474302..474322,474357..474440,474530..474958)
FT                   /codon_start=1
FT                   /gene_family="HOG000223675" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16263254"
FT                   /orf_name="AFUA_6G02520"
FT                   /product="Eukaryotic translation initiation factor eIF-1A
FT                   subunit, putative"
FT                   /function="translation initiation factor activity "
FT                   /protein_id="EAL85788.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="HOGENOM:HBG411380"
FT                   /db_xref="HOGENOM:HBG521228"
FT                   /db_xref="InterPro:IPR001253"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018104"
FT                   /db_xref="UniParc:UPI0000520456"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCV0"
FT                   /transl_table=1
FT                   /translation="MPKNKGKRVPRLRKFFTAISSYQPVWLRCANAAITGGKNRRRGKN
FT                   ENDNEKRELVFKEEGQEYAQVVKMLGNGRLEAMCFDGEKRLAHIRGKLRKKVWINQGDI
FT                   ILLSLRDYQDEKGDVIMKYTADEARSLKAYGELPEHAKINETDTYGHEGFEDNVEFDED
FT                   RESEDEKEIDVDEL"
     MPKNKGKRVP RLRKFFTAIS SYQPVWLRCA NAAITGGKNR RRGKNENDNE KRELVFKEEG        60
     QEYAQVVKML GNGRLEAMCF DGEKRLAHIR GKLRKKVWIN QGDIILLSLR DYQDEKGDVI       120
     MKYTADEARS LKAYGELPEH AKINETDTYG HEGFEDNVEF DEDRESEDEK EIDVDEL          177
//

If you have problems or comments...

PBIL Back to PBIL home page