(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE139

ASFUM1_6.PE139       Location/Qualifiers
FT   CDS             join(complement(479950..480097),complement(479835..479896))
FT                   /codon_start=1
FT                   /gene_family="HOG000202183" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263256"
FT                   /orf_name="AFUA_6G02535"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27242.1"
FT                   /db_xref="HOGENOM:HBG325069"
FT                   /db_xref="UniParc:UPI0000F51CCE"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA24"
FT                   /transl_table=1
FT                   /translation="MPVIPSDTSNFPTAQGSNNPEDNSSKGSEREQKKATAFDHISKGP
FT                   QIPDSMPPKASRDEIEQRKKELNQ"
     MPVIPSDTSN FPTAQGSNNP EDNSSKGSER EQKKATAFDH ISKGPQIPDS MPPKASRDEI        60
     EQRKKELNQ                                                                69
//

If you have problems or comments...

PBIL Back to PBIL home page