(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE144

ASFUM1_6.PE144       Location/Qualifiers
FT   CDS             join(491908..492092,492134..492518)
FT                   /codon_start=1
FT                   /gene_family="HOG000048646" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263259"
FT                   /orf_name="AFUA_6G02575"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85782.1"
FT                   /db_xref="HOGENOM:HBG056325"
FT                   /db_xref="UniParc:UPI0000520937"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCV6"
FT                   /transl_table=1
FT                   /translation="MVENKFIKVDRESFPYVFVKDVDISLKTHEKGLAQVDWPIPDTQY
FT                   TKFFLTPKQTLLQISDILPRTSDLVLPDAHLGSAGRPSLFGIRRPQHWRSPATYRYISP
FT                   FSAPEQSKSRLRRTISTCSSRCARECGREASLYTGTMGDPVPIMKGWLRVSLREVNENH
FT                   PFHCDYLPHRDYASADVQPVKAGEKY"
     MVENKFIKVD RESFPYVFVK DVDISLKTHE KGLAQVDWPI PDTQYTKFFL TPKQTLLQIS        60
     DILPRTSDLV LPDAHLGSAG RPSLFGIRRP QHWRSPATYR YISPFSAPEQ SKSRLRRTIS       120
     TCSSRCAREC GREASLYTGT MGDPVPIMKG WLRVSLREVN ENHPFHCDYL PHRDYASADV       180
     QPVKAGEKY                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page