(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE147

ASFUM1_6.PE147       Location/Qualifiers
FT   CDS             join(498109..498126,498177..498457,498585..498848,
FT                   498902..499156,499213..499282)
FT                   /codon_start=1
FT                   /gene_family="HOG000221683" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263261"
FT                   /orf_name="AFUA_6G02600"
FT                   /product="Phosphoglycerate mutase family protein "
FT                   /EC_number="5.4.2.1"
FT                   /function="phosphoglycerate mutase activity"
FT                   /protein_id="EAL85779.1"
FT                   /db_xref="GO:0004619"
FT                   /db_xref="HOGENOM:HBG469482"
FT                   /db_xref="HOGENOM:HBG658938"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="UniParc:UPI000051F8D7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCV9"
FT                   /transl_table=1
FT                   /translation="MFDYQLRNLGFLTYLLSVATKVDSIKRRTLKSVIANTRGKEMTPR
FT                   CFIVRHGETEWSLNGRHTGSTDLPLTANGEKRIKATGKALVGNDRLIVPKKLAHVYVSP
FT                   RTRAQRTLELLEIGCKERLPWTEARKSEEEEPIRTEAKVEITDAIREWDYGDYEGLTSK
FT                   QIRELREKNGQGPWDIWRDGCPGGETCTAQLMKVNPDRSPEDVIRRLDALIAEIREKFH
FT                   NKYFEGSSGGKGDVLIVAHGHILRAFAMRWTGKPLSETTLILEAGGVGTLSYEHDNIHE
FT                   PAIILGTAGFVVEE"
     MFDYQLRNLG FLTYLLSVAT KVDSIKRRTL KSVIANTRGK EMTPRCFIVR HGETEWSLNG        60
     RHTGSTDLPL TANGEKRIKA TGKALVGNDR LIVPKKLAHV YVSPRTRAQR TLELLEIGCK       120
     ERLPWTEARK SEEEEPIRTE AKVEITDAIR EWDYGDYEGL TSKQIRELRE KNGQGPWDIW       180
     RDGCPGGETC TAQLMKVNPD RSPEDVIRRL DALIAEIREK FHNKYFEGSS GGKGDVLIVA       240
     HGHILRAFAM RWTGKPLSET TLILEAGGVG TLSYEHDNIH EPAIILGTAG FVVEE            295
//

If you have problems or comments...

PBIL Back to PBIL home page