(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE16

ASFUM1_6.PE16        Location/Qualifiers
FT   CDS             77546..78754
FT                   /codon_start=1
FT                   /gene_family="HOG000268409" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750569"
FT                   /orf_name="AFUA_6G00260"
FT                   /product="Phosphatidylserine decarboxylase family protein "
FT                   /EC_number="4.1.1.-"
FT                   /function="phosphatidylserine decarboxylase activity "
FT                   /biological_process="phospholipid biosynthetic process "
FT                   /protein_id="EAL84239.1"
FT                   /db_xref="GO:0004609"
FT                   /db_xref="GO:0008654"
FT                   /db_xref="HOGENOM:HBG007377"
FT                   /db_xref="HOGENOM:HBG298423"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR005221"
FT                   /db_xref="InterPro:IPR022237"
FT                   /db_xref="UniParc:UPI0000520793"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8Y0"
FT                   /transl_table=1
FT                   /translation="MLAHSMFDEVPEKAPYDRDPTTLKKQVRNYKTMLYLFNTLLTEVP
FT                   EYFLVNDPDVPSGLIGFPFNVIVDWPMGTQSGRQFFLDPRVNGCLKAILNKWNDFLSDP
FT                   TGGTGQEGGGNQALIDAGWSSDIAVQQLEKKANDATPGSKRKFTELFIHSEGGTQENFF
FT                   KYACWDDFFTRKFRPGVRPVGDGAVVNACESFPLSFDTDVSGRTTFWLKGMPYSLHDML
FT                   GATQDDRVSQYVDKFVGGTVYQAFLSADSYHCWNAPVSGTVVYQSRIDGTYFAETPASG
FT                   FGGSSGPDPAGPDMSQRYITHVAARGVLIVNTNVPNGSQVGFVGFIPVGMSEVSTCRWE
FT                   DKIVEGCTITKGEDIGAFHSGGSTHCLIFERAYARRLKFDPRAQYPEIATANLAVNSTL
FT                   ATL"
     MLAHSMFDEV PEKAPYDRDP TTLKKQVRNY KTMLYLFNTL LTEVPEYFLV NDPDVPSGLI        60
     GFPFNVIVDW PMGTQSGRQF FLDPRVNGCL KAILNKWNDF LSDPTGGTGQ EGGGNQALID       120
     AGWSSDIAVQ QLEKKANDAT PGSKRKFTEL FIHSEGGTQE NFFKYACWDD FFTRKFRPGV       180
     RPVGDGAVVN ACESFPLSFD TDVSGRTTFW LKGMPYSLHD MLGATQDDRV SQYVDKFVGG       240
     TVYQAFLSAD SYHCWNAPVS GTVVYQSRID GTYFAETPAS GFGGSSGPDP AGPDMSQRYI       300
     THVAARGVLI VNTNVPNGSQ VGFVGFIPVG MSEVSTCRWE DKIVEGCTIT KGEDIGAFHS       360
     GGSTHCLIFE RAYARRLKFD PRAQYPEIAT ANLAVNSTLA TL                          402
//

If you have problems or comments...

PBIL Back to PBIL home page