(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE162

ASFUM1_6.PE162       Location/Qualifiers
FT   CDS             join(556816..556898,556996..558145)
FT                   /codon_start=1
FT                   /gene_family="HOG000202038" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263269"
FT                   /orf_name="AFUA_6G02740"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85765.1"
FT                   /db_xref="HOGENOM:HBG056312"
FT                   /db_xref="HOGENOM:HBG327005"
FT                   /db_xref="UniParc:UPI000051ECAF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCX3"
FT                   /transl_table=1
FT                   /translation="MEYHFVPPEERAKDDKGNLLPWGYVYKDEARNPRRPPEESGPFGK
FT                   RRNARYEQARSRTRTGTPAKRENPNVAEFGRLFAQQQEEEKSRNILPKSSSSSSLDNTR
FT                   KQTEKIATECILYGYRSKDGEWKVIDKYEKISRGLICEDYPRSDPNSTNGFAQLLSGGD
FT                   VVIRSNLSADANRKSKRYAGGFHWIKVTFDSTIAADRACFYSPQEIDGHLVFCELYHGS
FT                   GPAEDAPIPVDSSKAVQFKSKAPRTLTTSHSTTFLQPQDKDRAATLPRSFAMNNLSGVA
FT                   ESQEEASQISTSTASSATATGIEQPSALQQRNVSKESKPESEFMTHIPTVRRTKLRPIS
FT                   EALPPQPTVTERVLRSIPILSWFTGDIVGDGPQLREDGSFDYDKSNAYWRFWYMVDMIL
FT                   GTDICGLKEES"
     MEYHFVPPEE RAKDDKGNLL PWGYVYKDEA RNPRRPPEES GPFGKRRNAR YEQARSRTRT        60
     GTPAKRENPN VAEFGRLFAQ QQEEEKSRNI LPKSSSSSSL DNTRKQTEKI ATECILYGYR       120
     SKDGEWKVID KYEKISRGLI CEDYPRSDPN STNGFAQLLS GGDVVIRSNL SADANRKSKR       180
     YAGGFHWIKV TFDSTIAADR ACFYSPQEID GHLVFCELYH GSGPAEDAPI PVDSSKAVQF       240
     KSKAPRTLTT SHSTTFLQPQ DKDRAATLPR SFAMNNLSGV AESQEEASQI STSTASSATA       300
     TGIEQPSALQ QRNVSKESKP ESEFMTHIPT VRRTKLRPIS EALPPQPTVT ERVLRSIPIL       360
     SWFTGDIVGD GPQLREDGSF DYDKSNAYWR FWYMVDMILG TDICGLKEES                  410
//

If you have problems or comments...

PBIL Back to PBIL home page