(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE163

ASFUM1_6.PE163       Location/Qualifiers
FT   CDS             join(complement(559625..559767),complement(559248..559420),
FT                   complement(558922..559166))
FT                   /codon_start=1
FT                   /gene_family="HOG000261245" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16263270"
FT                   /gene_name="egd1"
FT                   /orf_name="AFUA_6G02750"
FT                   /product="Nascent polypeptide-associated complex subunit
FT                   beta"
FT                   /biological_process="protein transport"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85764.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG244178"
FT                   /db_xref="HOGENOM:HBG629031"
FT                   /db_xref="InterPro:IPR002715"
FT                   /db_xref="UniParc:UPI0000520214"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WCX4"
FT                   /transl_table=1
FT                   /translation="MDQAKLARMQASVRIGTFCSFLWIFEVLESESVFSADGFQAHHLG
FT                   NVIGKGTPRRKVKKVHKSSGADDKKLQTTLKKMNVQPIQAIEEVNMFKEDGNVIHFAAP
FT                   KVHASVPSNTFALYGNGEEKELTELVPGILNQLGPDSLASLRKLAESYQNMQKQAGAEG
FT                   KKDEDEDDIPDLVEGENFESNVE"
     MDQAKLARMQ ASVRIGTFCS FLWIFEVLES ESVFSADGFQ AHHLGNVIGK GTPRRKVKKV        60
     HKSSGADDKK LQTTLKKMNV QPIQAIEEVN MFKEDGNVIH FAAPKVHASV PSNTFALYGN       120
     GEEKELTELV PGILNQLGPD SLASLRKLAE SYQNMQKQAG AEGKKDEDED DIPDLVEGEN       180
     FESNVE                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page