(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE165

ASFUM1_6.PE165       Location/Qualifiers
FT   CDS             join(complement(562867..563050),complement(561936..562789))
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750832"
FT                   /orf_name="AFUA_6G02770"
FT                   /product="Short-chain dehydrogenase/reductase family
FT                   protein, putative"
FT                   /EC_number="1.-.-.-"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85762.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG533752"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00005206C7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCX6"
FT                   /transl_table=1
FT                   /translation="MALSNFAFAASFASHAIFHPLDFYSSVGPTLNESTFGLLGSPFDP
FT                   RHDITDLSGKVIFVTGGNIGLGKETILQLAYHRPSRIYLGARNATKARDAITDIQRQLS
FT                   TPVDIRHIPLDLASFASIRSAAAKFTSECDRLDILILNAGTMGNPPTTTEEGFEVQFGT
FT                   NHIGHFLLTKLLLPVLQKTAASPASTDVRVVTLASLANCAAPSYDVMTSTGALLAASTW
FT                   TRYAASKAANILFASELARRYPNILSVSVHPGTVTSNLYEHAKASSPVSKYSVAALSLF
FT                   FRSVRSGALNQLWAAGAKRELLTNGAYYIPIGNHAKNNKYATDADMAKRLWEWTEAQIS
FT                   EKFVP"
     MALSNFAFAA SFASHAIFHP LDFYSSVGPT LNESTFGLLG SPFDPRHDIT DLSGKVIFVT        60
     GGNIGLGKET ILQLAYHRPS RIYLGARNAT KARDAITDIQ RQLSTPVDIR HIPLDLASFA       120
     SIRSAAAKFT SECDRLDILI LNAGTMGNPP TTTEEGFEVQ FGTNHIGHFL LTKLLLPVLQ       180
     KTAASPASTD VRVVTLASLA NCAAPSYDVM TSTGALLAAS TWTRYAASKA ANILFASELA       240
     RRYPNILSVS VHPGTVTSNL YEHAKASSPV SKYSVAALSL FFRSVRSGAL NQLWAAGAKR       300
     ELLTNGAYYI PIGNHAKNNK YATDADMAKR LWEWTEAQIS EKFVP                       345
//

If you have problems or comments...

PBIL Back to PBIL home page