(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE168

ASFUM1_6.PE168       Location/Qualifiers
FT   CDS             join(complement(570450..570866),complement(570078..570389))
FT                   /codon_start=1
FT                   /gene_family="HOG000202016" [ FAMILY / ALN / TREE ]
FT                   /evidence="1: Evidence at protein level "
FT                   /gene_id="IGI16263272"
FT                   /orf_name="AFUA_6G02800"
FT                   /product="Uncharacterized protein AFUA_6G02800 "
FT                   /function="transferase activity"
FT                   /cellular_component="anchored to membrane"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="EAL85759.1"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0031225"
FT                   /db_xref="HOGENOM:HBG056310"
FT                   /db_xref="HOGENOM:HBG326968"
FT                   /db_xref="UniParc:UPI000051EA6E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WCX9"
FT                   /transl_table=1
FT                   /translation="MKFSPAYLLAFAPIVAAHFRLQYPTSRGFNADTMANFPCGDLAQS
FT                   SNRTQVSLSSGSFPVALRMGHDETAVEVLLALGNDPGTNFNITLHPTFRIEGLGEFCLP
FT                   NVVFDESVLGTKITDGMNATLQVQSNGDPSGGLYACADIQFSTTAQDEKPSSCTNNTGI
FT                   SAIAFTGAAAERNANESTADGQAQSGSSGSSSDSGSHSGHSSATQTSSTTASSTAGAVA
FT                   LETAAWGILGAAVVGGLAVL"
     MKFSPAYLLA FAPIVAAHFR LQYPTSRGFN ADTMANFPCG DLAQSSNRTQ VSLSSGSFPV        60
     ALRMGHDETA VEVLLALGND PGTNFNITLH PTFRIEGLGE FCLPNVVFDE SVLGTKITDG       120
     MNATLQVQSN GDPSGGLYAC ADIQFSTTAQ DEKPSSCTNN TGISAIAFTG AAAERNANES       180
     TADGQAQSGS SGSSSDSGSH SGHSSATQTS STTASSTAGA VALETAAWGI LGAAVVGGLA       240
     VL                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page