(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE174

ASFUM1_6.PE174       Location/Qualifiers
FT   CDS             join(complement(585369..585540),complement(585046..585228),
FT                   complement(583081..585002))
FT                   /codon_start=1
FT                   /gene_family="HOG000201961" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263275"
FT                   /orf_name="AFUA_6G02850"
FT                   /product="C6 finger domain protein, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85753.2"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG056306"
FT                   /db_xref="HOGENOM:HBG325067"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="UniParc:UPI0000F51CF0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCY5"
FT                   /transl_table=1
FT                   /translation="MDDIKIPSPTTILDTTPTISSSAGTFDSVSSIKGSASPNRTTKGV
FT                   VTDKPKQSKSRNGCITCKAKRLKCDESKPTCLQCKKRNVECGGYKKDFKWRPFEETNVI
FT                   SRISSIQARKSKCTGDPARSGKERRASHSVQAGKDRQPWPVSPRSPTPTASSLDSNDAA
FT                   LIHTLQSGISPSTDSPLALTQENLTSWNSGIARFLDFSNAEDELLTPLFTNSSPPEQSP
FT                   QLSDIVPSALDIHTSPMRRPLGLASQNTLRPGNLSFAALLEEDNDKIEEIARQSDKPID
FT                   PWLVGVSDGGAPSETSNTPAMLTKEPNFDIASPEMLALQFDRFTCGILSVKDGLNENPW
FT                   RTLIWPLAGETPALYHAIFSMTAFHSSKDNPGLRMHGVDHMRRSITYMVQDIQNMRTDA
FT                   ALATSLALAFADTWDQNTRNCIQHVRGAKALVLQVLKSKARDANDIERIRFLYNTWLYM
FT                   DAIARLTSRDDDGDQDMNFSIFQLPRDAVHEIDPLMGCATTLFPLINQVARLIQRVRNM
FT                   ESNSISLVSRAIELKRLIEQWEPPEWFVPPEDPTSEVQHSIQTAHAYRWATLLYLHQAV
FT                   PEMPSEPASDLAKRVLILLATVPPGSRTIIVQMFPLIAAGCEAEPGEDRQWVLTRWRAI
FT                   QSRLMIGSIDRCIEVVQEVWSRRDAIEAEKQRRQERVLSSSSRQSKGGPGLRSQGTREQ
FT                   FMSSPAIPSDLAVSSRPPFVGTRRSSAVSPLENIEFEKTVRGRLHWVSVMQEWGWEGES
FT                   LSCSV"
     MDDIKIPSPT TILDTTPTIS SSAGTFDSVS SIKGSASPNR TTKGVVTDKP KQSKSRNGCI        60
     TCKAKRLKCD ESKPTCLQCK KRNVECGGYK KDFKWRPFEE TNVISRISSI QARKSKCTGD       120
     PARSGKERRA SHSVQAGKDR QPWPVSPRSP TPTASSLDSN DAALIHTLQS GISPSTDSPL       180
     ALTQENLTSW NSGIARFLDF SNAEDELLTP LFTNSSPPEQ SPQLSDIVPS ALDIHTSPMR       240
     RPLGLASQNT LRPGNLSFAA LLEEDNDKIE EIARQSDKPI DPWLVGVSDG GAPSETSNTP       300
     AMLTKEPNFD IASPEMLALQ FDRFTCGILS VKDGLNENPW RTLIWPLAGE TPALYHAIFS       360
     MTAFHSSKDN PGLRMHGVDH MRRSITYMVQ DIQNMRTDAA LATSLALAFA DTWDQNTRNC       420
     IQHVRGAKAL VLQVLKSKAR DANDIERIRF LYNTWLYMDA IARLTSRDDD GDQDMNFSIF       480
     QLPRDAVHEI DPLMGCATTL FPLINQVARL IQRVRNMESN SISLVSRAIE LKRLIEQWEP       540
     PEWFVPPEDP TSEVQHSIQT AHAYRWATLL YLHQAVPEMP SEPASDLAKR VLILLATVPP       600
     GSRTIIVQMF PLIAAGCEAE PGEDRQWVLT RWRAIQSRLM IGSIDRCIEV VQEVWSRRDA       660
     IEAEKQRRQE RVLSSSSRQS KGGPGLRSQG TREQFMSSPA IPSDLAVSSR PPFVGTRRSS       720
     AVSPLENIEF EKTVRGRLHW VSVMQEWGWE GESLSCSV                               758
//

If you have problems or comments...

PBIL Back to PBIL home page