(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE179

ASFUM1_6.PE179       Location/Qualifiers
FT   CDS             join(complement(605275..605385),complement(604822..605053),
FT                   complement(604728..604750))
FT                   /codon_start=1
FT                   /gene_family="HOG000042711" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750834"
FT                   /orf_name="AFUA_6G02920"
FT                   /product="SNARE protein Snc2, putative "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85746.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="HOGENOM:HBG386095"
FT                   /db_xref="HOGENOM:HBG519078"
FT                   /db_xref="InterPro:IPR001388"
FT                   /db_xref="InterPro:IPR016444"
FT                   /db_xref="UniParc:UPI00005206C5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCZ2"
FT                   /transl_table=1
FT                   /translation="MSEQPYDPYIPSGSNGPSASAGSAAQNGDPRTREIDRKIQETVDT
FT                   MRSNIFKVSERGERLDSLQDKTDNLAVSAQGFRRGANRVRKQMWWKDMKMRVCLVICII
FT                   CLLIVIIVPAVVTTTKH"
     MSEQPYDPYI PSGSNGPSAS AGSAAQNGDP RTREIDRKIQ ETVDTMRSNI FKVSERGERL        60
     DSLQDKTDNL AVSAQGFRRG ANRVRKQMWW KDMKMRVCLV ICIICLLIVI IVPAVVTTTK       120
     H                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page