(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE18

ASFUM1_6.PE18        Location/Qualifiers
FT   CDS             82982..83917
FT                   /codon_start=1
FT                   /gene_family="HOG000254185" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262212"
FT                   /orf_name="AFUA_6G00280"
FT                   /product="NmrA-like family protein "
FT                   /EC_number="1.3.1.-"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84237.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG056438"
FT                   /db_xref="HOGENOM:HBG334425"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051E42D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8Y2"
FT                   /transl_table=1
FT                   /translation="MAGCAKILVIGAGELGNQVLHALAQHPNRGGATIAVLLRPSSIAS
FT                   THPDKVKELEELRNLNVQLIPGDIAKDSEEQLSDIFGEYGTIIGCTGFAAGSGTQLKLT
FT                   RAVLAAQVPRYVPWQFGVDYDIIGRGSAQDLFDEQLDVRDLLRSQNRTKWAIISTGMFT
FT                   SFLFEPWFGVVNFKGDTVTALGSLDTKVTVTAPEDIGRITAEAVLGSRADSVFGDKPIY
FT                   VAGDTLTYEQLGQLVERITGRKFTRHVRTVEAARADLARDPGNTLFKYQIVFGEGRGVA
FT                   WDLSETWNCQVGIRALTAEEWARRNLQNIM"
     MAGCAKILVI GAGELGNQVL HALAQHPNRG GATIAVLLRP SSIASTHPDK VKELEELRNL        60
     NVQLIPGDIA KDSEEQLSDI FGEYGTIIGC TGFAAGSGTQ LKLTRAVLAA QVPRYVPWQF       120
     GVDYDIIGRG SAQDLFDEQL DVRDLLRSQN RTKWAIISTG MFTSFLFEPW FGVVNFKGDT       180
     VTALGSLDTK VTVTAPEDIG RITAEAVLGS RADSVFGDKP IYVAGDTLTY EQLGQLVERI       240
     TGRKFTRHVR TVEAARADLA RDPGNTLFKY QIVFGEGRGV AWDLSETWNC QVGIRALTAE       300
     EWARRNLQNI M                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page