(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE180

ASFUM1_6.PE180       Location/Qualifiers
FT   CDS             join(complement(607194..607434),complement(607003..607130))
FT                   /codon_start=1
FT                   /gene_family="HOG000048644" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263278"
FT                   /orf_name="AFUA_6G02930"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85745.1"
FT                   /db_xref="HOGENOM:HBG056299"
FT                   /db_xref="InterPro:IPR012420"
FT                   /db_xref="UniParc:UPI000051F8C1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCZ3"
FT                   /transl_table=1
FT                   /translation="MATVFRYAHLTTLSFSLNSGTVICVGGPAFVQSIRPTDEELFKRY
FT                   NPDLQKRSLEEGDRRAREFDEYVTRLKQWSKSDKSIWFAAQEQQEQKRAETESQRSQAK
FT                   EEARLQREEMRKELLGEK"
     MATVFRYAHL TTLSFSLNSG TVICVGGPAF VQSIRPTDEE LFKRYNPDLQ KRSLEEGDRR        60
     AREFDEYVTR LKQWSKSDKS IWFAAQEQQE QKRAETESQR SQAKEEARLQ REEMRKELLG       120
     EK                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page