(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE182

ASFUM1_6.PE182       Location/Qualifiers
FT   CDS             join(613387..613686,613745..613917,613973..614133,
FT                   614241..614662)
FT                   /codon_start=1
FT                   /gene_family="HOG000236849" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263280"
FT                   /orf_name="AFUA_6G02950"
FT                   /product="Aromatic ring-opening dioxygenase LigB subunit,
FT                   putative"
FT                   /function="ferrous iron binding"
FT                   /function="oxidoreductase activity, acting on single donors
FT                   with incorporation of molecular oxygen, incorporation of
FT                   two atoms of oxygen"
FT                   /biological_process="cellular aromatic compound metabolic
FT                   process"
FT                   /protein_id="EAL85743.1"
FT                   /db_xref="GO:0006725"
FT                   /db_xref="GO:0008198"
FT                   /db_xref="GO:0016702"
FT                   /db_xref="HOGENOM:HBG058265"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="UniParc:UPI000051FFDB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCZ5"
FT                   /transl_table=1
FT                   /translation="MSTSADTHPPSTSNQHTSKKLVILSLASLLVAILLAAFGYGLSTE
FT                   NTNTNITAKLFGLRRLFGTQSAAAAAVKRDISTSSAIPKSGSTMKTPVYFLSHGGPNIM
FT                   YEQDHPAYRKLSEIGREITTKVKPRAVVVFSAHWQAGRDTIQVNTAEMTDLIYDFYGFP
FT                   SHYYKEKFPNVGSKEIANKVLSALKEAGIKAEGVKRGLDHGVWASFKCVQVSLFNTEDP
FT                   AQHYRLGQAVSKLRDDNILIIVSGMAVHNLRDLQFTWGNPKPMPYTTSFDEALKDAVTK
FT                   PPAEREQAMSDLLKRPDARQAHPSFDHLLPIHIGAGAAGDDLGKRLWTLKEGSMSWAQY
FT                   RFGDVGNNSAL"
     MSTSADTHPP STSNQHTSKK LVILSLASLL VAILLAAFGY GLSTENTNTN ITAKLFGLRR        60
     LFGTQSAAAA AVKRDISTSS AIPKSGSTMK TPVYFLSHGG PNIMYEQDHP AYRKLSEIGR       120
     EITTKVKPRA VVVFSAHWQA GRDTIQVNTA EMTDLIYDFY GFPSHYYKEK FPNVGSKEIA       180
     NKVLSALKEA GIKAEGVKRG LDHGVWASFK CVQVSLFNTE DPAQHYRLGQ AVSKLRDDNI       240
     LIIVSGMAVH NLRDLQFTWG NPKPMPYTTS FDEALKDAVT KPPAEREQAM SDLLKRPDAR       300
     QAHPSFDHLL PIHIGAGAAG DDLGKRLWTL KEGSMSWAQY RFGDVGNNSA L                351
//

If you have problems or comments...

PBIL Back to PBIL home page