(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE183

ASFUM1_6.PE183       Location/Qualifiers
FT   CDS             join(complement(615205..615290),complement(615029..615135),
FT                   complement(614925..614957),complement(614806..614864))
FT                   /codon_start=1
FT                   /gene_family="HOG000201916" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902862"
FT                   /orf_name="AFUA_6G02960"
FT                   /product="NADH-ubiquinone oxidoreductase 105 kDa subunit "
FT                   /protein_id="EAL85742.1"
FT                   /db_xref="HOGENOM:HBG027451"
FT                   /db_xref="HOGENOM:HBG464594"
FT                   /db_xref="InterPro:IPR007741"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR016464"
FT                   /db_xref="UniParc:UPI000051EA7A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCZ6"
FT                   /transl_table=1
FT                   /translation="MSSKYAFSKGLKELRFLFCQTSEQSAATRSFLQRAYPTMKKHNPQ
FT                   TPILIREAAGTLPRVYARYGFGKEKQESLSGLSDQQIEEKVSQLVKESS"
     MSSKYAFSKG LKELRFLFCQ TSEQSAATRS FLQRAYPTMK KHNPQTPILI REAAGTLPRV        60
     YARYGFGKEK QESLSGLSDQ QIEEKVSQLV KESS                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page