(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE193

ASFUM1_6.PE193       Location/Qualifiers
FT   CDS             join(643419..643586,643661..644397,644457..644859,
FT                   644937..645224)
FT                   /codon_start=1
FT                   /gene_family="HOG000202870" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16263285"
FT                   /orf_name="AFUA_6G03060"
FT                   /product="MFS monosaccharide transporter, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85732.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG534647"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051FB59"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD06"
FT                   /transl_table=1
FT                   /translation="MSDVGVDTSRVEAPVTWKTYMMCAFAAFGGIFFGYDSGYISGVMA
FT                   MDYFITEFEGLDKATTPADLFVIPSWKKSLITSILSAGTFFGSLIAGDLSDWFGRRTTI
FT                   VAGCAIFIVGVVLQTASAATALLVVGRLIAGFGVGFVSAIIILYMSEIAPRKVRGAIVS
FT                   GYQFCITIGLMLASCVDYATQNRTDSGSYRIPIGVQIAWALILGAGLLLLPESPRYFVK
FT                   KGDLTRAAEALGRVRDQPRDSELIRSELAEIVANHEYEMQAIPQSGYFGSWFNCFRGSL
FT                   WNPNSNLRRTVLGTSLQMMQQWTGVNFVFYFGTTFFKSLGTISDPFLISMITTIVNVCS
FT                   TPISFYTMEKLGRRTLLLWGALGMVVCQFIVAIVGTVDGSNKSAVSAEISFICIYIFFF
FT                   ASTWGPGAWVVIGEIYPLPIRSRGVALSTASNWLWNCIIAVITPYMVDTDKGNLKAKVF
FT                   FIWGSLCACAFVYTYFLIPETKGLTLEQVDKMMEETTPRTSAKWKPHGTFAAEMGLTDK
FT                   DMAEKTAEVVHQEV"
     MSDVGVDTSR VEAPVTWKTY MMCAFAAFGG IFFGYDSGYI SGVMAMDYFI TEFEGLDKAT        60
     TPADLFVIPS WKKSLITSIL SAGTFFGSLI AGDLSDWFGR RTTIVAGCAI FIVGVVLQTA       120
     SAATALLVVG RLIAGFGVGF VSAIIILYMS EIAPRKVRGA IVSGYQFCIT IGLMLASCVD       180
     YATQNRTDSG SYRIPIGVQI AWALILGAGL LLLPESPRYF VKKGDLTRAA EALGRVRDQP       240
     RDSELIRSEL AEIVANHEYE MQAIPQSGYF GSWFNCFRGS LWNPNSNLRR TVLGTSLQMM       300
     QQWTGVNFVF YFGTTFFKSL GTISDPFLIS MITTIVNVCS TPISFYTMEK LGRRTLLLWG       360
     ALGMVVCQFI VAIVGTVDGS NKSAVSAEIS FICIYIFFFA STWGPGAWVV IGEIYPLPIR       420
     SRGVALSTAS NWLWNCIIAV ITPYMVDTDK GNLKAKVFFI WGSLCACAFV YTYFLIPETK       480
     GLTLEQVDKM MEETTPRTSA KWKPHGTFAA EMGLTDKDMA EKTAEVVHQE V                531
//

If you have problems or comments...

PBIL Back to PBIL home page