(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE2

ASFUM1_6.PE2         Location/Qualifiers
FT   CDS             join(34609..35939,35995..36790)
FT                   /codon_start=1
FT                   /gene_family="HOG000234843" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262204"
FT                   /orf_name="AFUA_6G00120"
FT                   /product="C6 transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL84255.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG056571"
FT                   /db_xref="HOGENOM:HBG326056"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000051EB23"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8W4"
FT                   /transl_table=1
FT                   /translation="MSRRSLGTTTPPSHPPASLPRSESPRASVTKRPLNTTNKSGDDEN
FT                   RRKDPKVSRACDTCKKKKIRCDGTIPCTNCTKRKVSCAYDMKYGRGRPPTPPSSAAIRE
FT                   HQNRLRSNYSYDLSNWQPPVSVAPEISSPLVHSRASPTGEIEGQYFDPTSGLNFLHRAW
FT                   KKLLTTQNDQPASYRLSVSEQNQLLTSAGDRPFHIESDALDSFIPDASTARKLQQFYFE
FT                   TCVVTYRMFHRPSVEGWMEIFLKDGQGAGPTARSLGKAKTATLLTIMAIANLRLHRVSG
FT                   ETSTEAESLALKRSDHLFCAGMRMTEEEIGFPRLESAQARLVQVLYLLQTSRINKAWYT
FT                   FGNAFQITLSLGMHRRRDQKRDYPFTSRRQDYITSECYKRTFWVAYTVDRYLSVVLGRP
FT                   RLYQDEDIDQNFPDTVNDEDMTPDGFSISDDPADCYIDALIYHAKIAQIIGKISREVYS
FT                   VSELYSQNRLAAAHRLGRELHEWRESLPPHLGTVKPTTLIPSFRRQAIALQLAYFHAII
FT                   HAYRPFLLSDAASEIVSECILATKACLELINKVARDSMLFHSFWWTHYVIFCALAVVYV
FT                   WEIQRTTRSLVETVDTSLGKIFELAEKCHGHLKRASTGLSQNQRYSVILDELRSEAQRC
FT                   RSLTTNPPKIDQEGACGGEASANANNGFRLLQDPNMFGTGLEAILPEGVMLNMPDSFLF
FT                   NDWQTLDSSVCISV"
     MSRRSLGTTT PPSHPPASLP RSESPRASVT KRPLNTTNKS GDDENRRKDP KVSRACDTCK        60
     KKKIRCDGTI PCTNCTKRKV SCAYDMKYGR GRPPTPPSSA AIREHQNRLR SNYSYDLSNW       120
     QPPVSVAPEI SSPLVHSRAS PTGEIEGQYF DPTSGLNFLH RAWKKLLTTQ NDQPASYRLS       180
     VSEQNQLLTS AGDRPFHIES DALDSFIPDA STARKLQQFY FETCVVTYRM FHRPSVEGWM       240
     EIFLKDGQGA GPTARSLGKA KTATLLTIMA IANLRLHRVS GETSTEAESL ALKRSDHLFC       300
     AGMRMTEEEI GFPRLESAQA RLVQVLYLLQ TSRINKAWYT FGNAFQITLS LGMHRRRDQK       360
     RDYPFTSRRQ DYITSECYKR TFWVAYTVDR YLSVVLGRPR LYQDEDIDQN FPDTVNDEDM       420
     TPDGFSISDD PADCYIDALI YHAKIAQIIG KISREVYSVS ELYSQNRLAA AHRLGRELHE       480
     WRESLPPHLG TVKPTTLIPS FRRQAIALQL AYFHAIIHAY RPFLLSDAAS EIVSECILAT       540
     KACLELINKV ARDSMLFHSF WWTHYVIFCA LAVVYVWEIQ RTTRSLVETV DTSLGKIFEL       600
     AEKCHGHLKR ASTGLSQNQR YSVILDELRS EAQRCRSLTT NPPKIDQEGA CGGEASANAN       660
     NGFRLLQDPN MFGTGLEAIL PEGVMLNMPD SFLFNDWQTL DSSVCISV                    708
//

If you have problems or comments...

PBIL Back to PBIL home page