(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE200

ASFUM1_6.PE200       Location/Qualifiers
FT   CDS             join(complement(664259..664367),complement(663878..664215))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264286"
FT                   /orf_name="AFUA_6G03130"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85725.1"
FT                   /db_xref="HOGENOM:HBG056287"
FT                   /db_xref="UniParc:UPI000051E5B5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD13"
FT                   /transl_table=1
FT                   /translation="MKHVAIPHVILGAIHQLSNISLFGGNPAIDLVDNDVENTRRISSP
FT                   PVTVTWSVCTVKVACGAKWATMASTSRSSTALKKLAGRDASRSRVRVMFGGLDVQIGKS
FT                   VITVGEFQMKIAVWIKWQIVKISGGLVPVLGKFNQQSAKVRYYQ"
     MKHVAIPHVI LGAIHQLSNI SLFGGNPAID LVDNDVENTR RISSPPVTVT WSVCTVKVAC        60
     GAKWATMAST SRSSTALKKL AGRDASRSRV RVMFGGLDVQ IGKSVITVGE FQMKIAVWIK       120
     WQIVKISGGL VPVLGKFNQQ SAKVRYYQ                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page