(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE202

ASFUM1_6.PE202       Location/Qualifiers
FT   CDS             join(668012..668188,668399..668706,668775..669582)
FT                   /codon_start=1
FT                   /gene_family="HOG000201861" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751075"
FT                   /orf_name="AFUA_6G03150"
FT                   /product="Putative uncharacterized protein "
FT                   /function="cation binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL85723.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG056285"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="UniParc:UPI00005206CF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD15"
FT                   /transl_table=1
FT                   /translation="MKTTTVASLLLAGTALGNPVHQKRDSVTAQVNFANNTGKPQHLAS
FT                   GILYGLPDTSNQIPTRFASALSNYKTSRQHGAKFIFLIHDLWGADGTQNSSAPYPGDNG
FT                   DWTSWDNYLTHLLSDIKANRMTDGLIIDIWNEPDLSFFWNRDQTQYLQMWGRTFHRLRS
FT                   ELAGVELSGPASAGEPLPGNNWWKNWASFVATNKSIPDQYAWHMEGGGGDLLSAQAGLV
FT                   YWQTTYGLPGRPININEYAVLDEEVPAGSAWWISQLERINAVGLRGNWLSGWKLHDFLA
FT                   SLLSKPNADNSNYDPTGTGYFPTGDYQVYKYYNLNMTGHRVGTLPSADLKLDAYAAVGD
FT                   DRVARVLVGVRIATGTWQLQLNQLSALGLPTSGTLNVHTWGFPVASNVHYGQVDGPKDL
FT                   GWYGHVYSGDSVTFPVYQTDTTSAYAFEFKI"
     MKTTTVASLL LAGTALGNPV HQKRDSVTAQ VNFANNTGKP QHLASGILYG LPDTSNQIPT        60
     RFASALSNYK TSRQHGAKFI FLIHDLWGAD GTQNSSAPYP GDNGDWTSWD NYLTHLLSDI       120
     KANRMTDGLI IDIWNEPDLS FFWNRDQTQY LQMWGRTFHR LRSELAGVEL SGPASAGEPL       180
     PGNNWWKNWA SFVATNKSIP DQYAWHMEGG GGDLLSAQAG LVYWQTTYGL PGRPININEY       240
     AVLDEEVPAG SAWWISQLER INAVGLRGNW LSGWKLHDFL ASLLSKPNAD NSNYDPTGTG       300
     YFPTGDYQVY KYYNLNMTGH RVGTLPSADL KLDAYAAVGD DRVARVLVGV RIATGTWQLQ       360
     LNQLSALGLP TSGTLNVHTW GFPVASNVHY GQVDGPKDLG WYGHVYSGDS VTFPVYQTDT       420
     TSAYAFEFKI                                                              430
//

If you have problems or comments...

PBIL Back to PBIL home page