(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE205

ASFUM1_6.PE205       Location/Qualifiers
FT   CDS             678426..679379
FT                   /codon_start=1
FT                   /gene_family="HOG000199933" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264288"
FT                   /orf_name="AFUA_6G03190"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85720.1"
FT                   /db_xref="HOGENOM:HBG052723"
FT                   /db_xref="HOGENOM:HBG326147"
FT                   /db_xref="UniParc:UPI0000520933"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD18"
FT                   /transl_table=1
FT                   /translation="MKDGRHRRLTPSTVSKTTTMTRTIHIAVLDVDIPPRSLYETHGLC
FT                   SAHFRHALQDAATRFNALTPGSDIRIAVTPYDIRGGHYPDFRHLRKTQTPLSEHSIDAI
FT                   LITGGAPGVYEIDKRPWMQTLAKFLQTVFREYPAVRIMGTCFGHQLIGHALVDSGAGDV
FT                   YVEKCPLGREVGIHTVQLNRDFVDAFPLALGHLPNGQLKIQMFHGDRVMVKGGTEGVLP
FT                   ETAAVSLPAPWVNIGSTPLCPIQGMYYPGRVLSVQGHYELDACGMQSMCLEFAPLLGWT
FT                   DSKLGLFLEQVGDDYNGRQDDSEAFALAVVCFLAGE"
     MKDGRHRRLT PSTVSKTTTM TRTIHIAVLD VDIPPRSLYE THGLCSAHFR HALQDAATRF        60
     NALTPGSDIR IAVTPYDIRG GHYPDFRHLR KTQTPLSEHS IDAILITGGA PGVYEIDKRP       120
     WMQTLAKFLQ TVFREYPAVR IMGTCFGHQL IGHALVDSGA GDVYVEKCPL GREVGIHTVQ       180
     LNRDFVDAFP LALGHLPNGQ LKIQMFHGDR VMVKGGTEGV LPETAAVSLP APWVNIGSTP       240
     LCPIQGMYYP GRVLSVQGHY ELDACGMQSM CLEFAPLLGW TDSKLGLFLE QVGDDYNGRQ       300
     DDSEAFALAV VCFLAGE                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page